SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000012709 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000012709
Domain Number 1 Region: 244-333
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.48e-20
Family Canonical RBD 0.00019
Further Details:      
 
Domain Number 2 Region: 393-480
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.02e-19
Family Canonical RBD 0.0001
Further Details:      
 
Domain Number 3 Region: 142-238
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.64e-18
Family Canonical RBD 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000012709
Domain Number - Region: 30-39
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0107
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000012709   Gene: ENSACAG00000012921   Transcript: ENSACAT00000012965
Sequence length 485
Comment pep:known_by_projection chromosome:AnoCar2.0:5:147159436:147174977:-1 gene:ENSACAG00000012921 transcript:ENSACAT00000012965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPPPRPGALAPPPRLRSRPQVATWSGLLPPPPRPPPPPMAAGTRWVLGALLRQTGAASA
SLGLSSSRRLLRFLGAAAAAAAATQSRGLSRSAGPVPGLSALPGRPLLAPALALHARTGF
AQDHSTPFQEEYPPLSEYEPHPAKSGEEEEDVYLIRAQGLPYSCTEEDVLNFFAGSKIRN
GVNGIHFLLNRDGKRRGDALVELESEQDVHNALEKHRRYLGQRYVEVFEIHNEDVDAIMK
SLQSSSTSVTNDGVVRLRGLPYSCTEVDISDFFSGLSIIDITFVMDQRGRRKTGEAFVQF
ATPEMANQALLKHKEEIGNRYIEIFPSQRSEIRTHNGFFRGKKMMGFPTTKQDSDSVFNE
GDFNEALRPVAAYENAKEHELFKQAFERPRDLQESRSFPSLHFVHLRGLPFQATAQDIIN
FFAPLKPVRITMEYNSSGKATGEADVHFETHEDAIAAMAKNRSHVQHRYIELFLNSSPSR
KNGCQ
Download sequence
Identical sequences G1KN05
XP_003221902.1.98722 ENSACAP00000012709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]