SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000012912 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSACAP00000012912
Domain Number - Region: 66-71,173-183
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00759
Family Formin homology 2 domain (FH2 domain) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000012912   Gene: ENSACAG00000013148   Transcript: ENSACAT00000013170
Sequence length 235
Comment pep:known_by_projection chromosome:AnoCar2.0:4:77923151:77926928:1 gene:ENSACAG00000013148 transcript:ENSACAT00000013170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELYVKPGNRERGWNDPPQFSYGLQQRQGPRGGAARRGGLARRPAEGTPEVDRVAAKTT
TPPLGPPPPPPAAAGLPASSPCPVGLPPPPSGLPVSCPQVDATNLLVSEDCVVEDVLSPL
NEALDNCRKTLRKQICDDIGKRLAILQQMWEQGKLSAPVRKGMRILIQEFKSQHWDAADE
IHRSLMVDHVTEVNQWMVGVKRLIAETRNLPTDNLATIEHEQKDKTSLEPECQHD
Download sequence
Identical sequences G1KNB2
ENSACAP00000012912 XP_003220029.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]