SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000013148 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000013148
Domain Number 1 Region: 12-119
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-39
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000187
Further Details:      
 
Domain Number 2 Region: 377-415
Classification Level Classification E-value
Superfamily Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.00000000000017
Family Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.0013
Further Details:      
 
Domain Number 3 Region: 188-198
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000251
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000013148   Gene: ENSACAG00000013325   Transcript: ENSACAT00000013408
Sequence length 417
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343270.1:1061955:1148626:-1 gene:ENSACAG00000013325 transcript:ENSACAT00000013408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFSSLFFSEQSICQARASVMVYDDTSKKWVPIKPGQQGFSRINIYHNTASNTFRVVGVKL
QDQQVVINYSIVKGLKYNQATPTFHQWRDARQVYGLNFASKEEATTFSNAMLFALNIMNS
QQDGGPTTQRQVQNGPSPDEMEIQRRQAMEQQQQQRQESLERRTSTTGPVLPPGHPSAAG
LPTLSGGPPPPPPPPPPPTGTAPPPPPPLPIGGGGTNIDDGSVSGLAAALAGAKLRRVQR
PEDGSGGSSPCGASKSDANRTSSGGGGLMEEMNKLLAKRRKAASQSDKPADKKEEESQNE
DASTSPSPVSRGPVQQQNSSDAGKKLWERSNSVEKPVASLLSRNPSVDTCSEPKSPIQYQ
PSSRMKPASSSNDVAMDTLDFDRMKQEILEEVVKELHKVKEEIIDAIRQELSRISTT
Download sequence
Identical sequences H9GJV7
ENSACAP00000013148 ENSACAP00000013148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]