SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000013400 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000013400
Domain Number 1 Region: 181-295
Classification Level Classification E-value
Superfamily Acid proteases 5.63e-28
Family Retroviral protease (retropepsin) 0.018
Further Details:      
 
Domain Number 2 Region: 2-42
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000414
Family Ubiquitin-related 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000013400
Domain Number - Region: 63-73,122-133
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00759
Family Formin homology 2 domain (FH2 domain) 0.1
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000013400   Gene: ENSACAG00000013614   Transcript: ENSACAT00000013674
Sequence length 358
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343609.1:137359:143660:1 gene:ENSACAG00000013614 transcript:ENSACAT00000013674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIVYAERPLTDNHRSLASYGLKDGDVVILQQVENAEARPPVPFPGLPRIDFSSIAVPGSS
SAPPPAPPPAPPPASASQPPPPDLPSSPQGLDNPALLRDMLLANPHELSLLKERNPPLAE
ALLSGDLEKFTRVLVEQQQDRARREQERIRLFSADPFDLEAQAKIEEDIRQQNIEENMTI
AMEEAPESFGQVVMLYINCKVNGHPVKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGI
AKGVGTQKIIGRVHLAQVQIEGDFLPCSFSILEEQPMDMLLGLDMLKRHQCSIDLKKNVL
VIGTTGSQTTFLPEGELPECARLAYGAGREEVRPEEIADHELAEALQKSVEEAGTKGR
Download sequence
Identical sequences H9GK35
ENSACAP00000013400 ENSACAP00000013400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]