SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000013451 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000013451
Domain Number 1 Region: 742-1121
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 1.03e-106
Family Formin homology 2 domain (FH2 domain) 0.00000000225
Further Details:      
 
Domain Number 2 Region: 104-467
Classification Level Classification E-value
Superfamily ARM repeat 5.76e-104
Family Diap1 N-terninal region-like 0.00000000648
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000013451   Gene: ENSACAG00000013498   Transcript: ENSACAT00000013727
Sequence length 1179
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343387.1:264740:298125:1 gene:ENSACAG00000013498 transcript:ENSACAT00000013727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAGQAGMESHGAEEGLGKMNPKRGGASGPEDESKNKPKLNLQIKTLADDVRDRITSFRKS
GVKKEKLLIQHPIDAQTSINELPVAQPLFDERSMNLSEKEVMDLFEKMMEDMNLNEERKT
PLRNKDLTTKREMVVQYISATAKSGGLKNSKHECTLSSQEYVHELRSGISDEKLLNCLES
LRVSLTSNPVSWVNNFGHEGLGLLLDVLEKLLDKKQQENIDKKNQHKLIQCLKAFMNNKY
GLQRILGDERSLFLLARAIDPKQPNMMTETVKILSAICIVGEENILDKILAAITTAAERN
NSERFTNIVEGLENHDVLQLQVACMQLINAFVTSPEDLDFRIHLRNEFLRCGLKKILPDL
KEKENEELDIQLKVFDENKEEDLLELAHRLNDIKVEMEYPFKSDVNEVYHLLYNMLKETS
SESYFLSILQHFLLIRNDYYVRPQYYKIIEECVSQIVLHCSGMDPDFKCRGRLDVDFTHL
IDSCVDKAKVEESEQKATEFSKKFDEEFAARQEAQSELQRREERIKELEAEIQRLRSQVI
VLASTQTLVSSISRLTFNINVGKSSTTFYYKRVMLMWRYFPGLRGFHSVPESLYWYKYVP
VEIPLTISTINDKKHPECDISHIVMGTQYASTVRYAPSCSSGLPPGGIPPPPPPPPLPGG
ATPAACPPPPPPPPLPGGLPPPPPPPPPLPGGAIPPPPPMPGGPPPPPPPFGGAPPLGTV
PQLPFGMTPKKKYSPEVSMKRINWTKVEPQEISENCFWLKAKEEKFASQDLFAKLAHTFA
TQMKVKKAVEGTEEKKIAMPKKRAKELRVLDGKTAQNLSIFLGSFRMPYDEIKNIIIEVD
EDKLSEALIQNLVKNLPEQKELSALAELRSEYEDLCEPEQFGVVMSSVKALRPRLNGILF
KLTFEEHINNIRPGIMAVTMACEELKKSESFSKMLELMLLIGNYMNSGSRNAQSLGFNLS
FLCKIRDTKSSDQKMTLLQFLAAICEEKYRDILKFPDELQHVESASKVSAQILKSSLDSM
KQQIERLESDIKKFPKTEDPHDKFVEKMSIFAKSSREQYEKLSNMHNNMTKLYDCLGDYF
CFDPKATSSEEFFGDLSTFRILFLEALKENNKRREMEEKIKRAKLAKEKAEREKLERQQK
KKQLIDMNKEGDETGVMDNLLEALQSGAAFRDRRKRMPR
Download sequence
Identical sequences H9GK55
ENSACAP00000013451 ENSACAP00000013451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]