SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000013955 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000013955
Domain Number 1 Region: 274-354,390-583
Classification Level Classification E-value
Superfamily Pectin lyase-like 9.59e-26
Family Pectin methylesterase 0.05
Further Details:      
 
Domain Number 2 Region: 667-830
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.14e-24
Family Pectate lyase-like 0.058
Further Details:      
 
Domain Number 3 Region: 162-245
Classification Level Classification E-value
Superfamily F-box domain 5.23e-21
Family F-box domain 0.0021
Further Details:      
 
Domain Number 4 Region: 585-698
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.08e-16
Family Galacturonase 0.038
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000013955
Domain Number - Region: 54-63
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000654
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000013955   Gene: ENSACAG00000014131   Transcript: ENSACAT00000014241
Sequence length 931
Comment pep:known_by_projection chromosome:AnoCar2.0:1:255206463:255298181:-1 gene:ENSACAG00000014131 transcript:ENSACAT00000014241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSVRAANRRPRRVSRPRPVQQPPPPPPPPPPPPPPPQAQQQQPPPQQQPLQLPPPPPPP
PPPERNNNNNAAAAAAAAAGERDDDVPADMVAEESGPGAQNSPYQLRRKTLLPKRTACPA
KSSMEGASTSATENFGHRAKRARVSGKSQDLSAPAEQYLQEKLPDEVVLKIFSYLLEQDL
CRAACVCKRFSELANDPILWKRLYMEVFEYTRPMMHPEPGKFYQINPEEYEHPNPWKESF
QQLYKGAHVKPGFAEHFYSNPARYKGRENMLYYDTIEDALGGVQEAHFDGLIFVHSGIYT
DEWIYIESPITMIGAAPGKVADKVIIENTRDSTFVFMEGSEDAYVGYMTIRFNPDDKSAQ
HHNAHHCLEITVNCSPIIDHCIIRSTCTVGSAVCVSGQGACPTIKHCNISDCENVGLYIT
DHAQGIYEDNEIFNNALAGIWVKNHGNPIIRRNHIHHGRDVGVFTFDHGMGYFESCNIHR
NRIAGFEVKAYANPTVVRCEIHHGQTGGIYVHEKGRGQFIENKIYANNFAGVWITSNSDP
TIRGNAIFNGNQGGVYIFGDGRGLIEGNDIYGNALAGIQIRTNSCPIVRHNKIHDGQHGG
IYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVLRRNRIHSGKQVGVYFYDNGHGVLEDN
DIYNHMYSGVQIRTGSNPKIRRNKIWGGQNGGILVYNSGLGFIEDNEIFDNAMAGVWIKT
DSNPTLRRNKIHDGRDGGICIFNGGRGLLEENDIFRNAQAGVLISTNSHPVLRKNRIFDG
FAAGIEITNHATATLEGNQIFNNRFGGLFLASGVNVTMKDNKIMNNQDAIEKAVSRGQCL
YKISSYTSYPMHDFYRCHTCNTTDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLS
NPCTLAGEPTHDTDTLYDSAPPIESNTLQHN
Download sequence
Identical sequences G1KPM4
ENSACAP00000013955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]