SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000014466 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000014466
Domain Number 1 Region: 801-924
Classification Level Classification E-value
Superfamily TNF-like 0.00000000000228
Family TNF-like 0.0086
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000014466
Domain Number - Region: 219-318
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0249
Family Formin homology 2 domain (FH2 domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000014466   Gene: ENSACAG00000014748   Transcript: ENSACAT00000014761
Sequence length 925
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343199.1:4232896:4304238:1 gene:ENSACAG00000014748 transcript:ENSACAT00000014761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTNSQPPPLFEEYWGTEFDTDETPNQAPTALTGLDHDNTGSDRSRNGNWCSSIRSRPIT
YIAACKTEKYIVKSQRPCPNGTPDCQKIMYRAALKPVYQVKHKVISSLYWKCCPGYSGKN
CEHHDPNFLPVPTDQPRSWEEYWPALVGGQKIRHPQKDTGEIIETHQSHEAQLEDLQNDV
QQATNRFAGSFDSIPKGSTDFICSSRIFEIEAFPNRIHQQTLFPHMENFLREHFQPVWAS
LNKSLQDLSTGLKNLSHDVEANRRSIERFQETTVPKKDFQELGTKFESKVQTIIFGVEEM
KRELEDHFHQQQAAIHYNLTMIKADTDIKLKRNHKNHLVDLSALNNSLSGMRQEQSKLQR
ELEALSRNLVFPIQPGSPNEAFAEEDTQILNQSLAKHARQLKELYEQSDEDYQELNQLIN
SLKASTKQETSELRINLMEKSLIIEEYRESMERKIVDLNNTLANIEERQWDLERSLKICH
CENLPLGIAVEEQENITQIYREEIKQLEARLKDLAAAFPLLYQSLDFQQEQNRKLEDDMS
LLRSHTDTLSEIMGTLKKTDEKMHGHIKYLNSSFNSLLVDAMRHEKALVAMLGDEIMETL
SEDDPHNLTLEYIMNRIQSLEMDHKNNLDAYTSLKNHDLDKQMEDMEKVVNTEQGIMEHM
EPNHEAAIEDAPVYQDIMILKKEIGHLNKEMKEINSCSPSPWSSNNRIQLGPTRAFCLDV
LEGTRQHPEIFEVLQISVLDAVGIGVLLVSGPLARREISLAVHPKCHPRAPHELQLPQQQ
KCEMSNLSHHNSLTGCQPGTKIAFYVRHPEGREHQTGFNGTHLNYGKGYFPEHNYFKAPQ
SGVYMVAISMELPPEPALGQLAFSNGQILILTGNKRRKASGGSMTTFVLVELMKGERMWF
ELVQDAVVKRNPAGLSMAGFLIFKT
Download sequence
Identical sequences L7N019
ENSACAP00000014466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]