SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000014984 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000014984
Domain Number 1 Region: 1127-1226
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.13e-34
Family CUT domain 0.0000122
Further Details:      
 
Domain Number 2 Region: 951-1031
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 9e-32
Family CUT domain 0.0000193
Further Details:      
 
Domain Number 3 Region: 564-643
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 2.6e-28
Family CUT domain 0.0000581
Further Details:      
 
Domain Number 4 Region: 1261-1321
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000599
Family Homeodomain 0.0065
Further Details:      
 
Domain Number 5 Region: 440-448
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000118
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000014984   Gene: ENSACAG00000015088   Transcript: ENSACAT00000015287
Sequence length 1539
Comment pep:novel scaffold:AnoCar2.0:GL343613.1:42830:286719:-1 gene:ENSACAG00000015088 transcript:ENSACAT00000015287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFQYWKRFDFPQLQRELDATATVLANRQDESEQSRKKLIEQSREFKKNTPEDLRKQVAPL
LKSFQGEIDALGKRSKEAEAAFLNVYKRLIDVPGSDPSPALDLGQQLQLKVQRMHDIETE
NQKLRETLEEYNKEFAEVKNQEVTIKALKEKIREYEQTLKNQAENLALEKEQKLQNDFAE
RERMLQETQISTASKLEEAEHKMQALQTALEKTQAELFDLKTKYDEETTAKSDEIEMIMT
DLERANQRAEVAQREAEALREQLSSANKSLQLATQIQKAPDVEQAIEVLTRSSLEAELAA
KEREIAQLVEDVQRLQGNLSKLRENSTSQISQLEQQLTAKNSTLKQLEEKLKVQADYDEV
KKELNILKSMEFALSDSSGTQDAASKPLEVLLLEKNRLLQSENATLRITNSDLSGSARRK
GKDQPESQRPAALPASPPPPPPPPPPPPPPQLPRNAGEQASNTNGTHQFPPTGLSQDFFS
SSLASSGLPLASTGKFALNSLLQRQLMQSFYSKAMQEAGSTSMIFSAGPYSTNSISSQSP
LQQSPDVNGISPSPGHSDGTTAAGGNNASDGEDMDTAEIARQVKEQLIKHNIGQRIFGHY
VLGLSQGSVSEILARPKPWNKLTVRGKEPFHKMKQFLSDEQNILALRSIQGRQRAKTGPS
PNGIFVSLPKKGNLVQCHITTRIRATEAGSDEAIKSILEQAKRELQVQKTATAEPPQPPS
LCSGGGSDEAIRSILQQARREMEAQQAALEPALKATQAEMSLLSPKLVPAPVGLSAVAGY
SPLPMSLKKHSSSSSSSAESGPTLKKEAPESPGLELLHGVSDASAQGVLRHVKNELGRSG
VWKDHWWSTVQPERRGAPLAPEEAPKAEEAPGGKEKRGGQAPQGPSSSSASSEYWKEWPN
AESPYSQGSELSVTGASRSETPQNSPLPSSPIVPLAKPSKPSVPPLTPEQYEIYMYQEVD
TIELTRQIKEKLAKNGICQRIFGEKVLGLSQGSVSDMLSRPKPWSKLTQKGREPFIRMQL
WLNGELGQGVLPSQGQPLGQALPSVASLQDALPQGCASSAESTPKTSASCSPAPESPMSS
SESVKSLTELVQQPCPIEAGKEGKLQEPGEASSATADPQPNVPLLLSGHSSLSIQELVAM
SPELDTYGITKRVKEVLTDNNLGQRLFGETILGLTQGSVSDLLARPKPWHKLSLKGREPF
VRMQLWLNDPNNVEKLMDMKRMEKKAYMKRRHSSVSDSQAPESSSSGLDYGQGSSPQAQH
HQLKKPRVVLAPEEKEALKRAYQQKPYPSPKTIEELATQLNLKTSTVINWFHNYRSRIRR
ELFIEEIQAGGQGQAGASDSPSARSARGVAHGSEGDSCDGVDADGPADAKLGVPDGEDDD
SGTATATKSQGGRAGAADGEEAGSSEKSGSREEDTDEEGGLGASPRPGGTGGATPNCAQE
EEGDASTSSACVLPGGRCSGQAKEERAGRIPIVPSTSSTPGARKANSLESLFGFSEATTA
CSKNSRDNSLRKKKAANLNSIIHRLEKAASREEPVEWEF
Download sequence
Identical sequences H9GM27
ENSACAP00000014984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]