SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000015144 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000015144
Domain Number 1 Region: 188-447
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 8.37e-110
Family Transcriptional factor tubby, C-terminal domain 0.0000000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000015144   Gene: ENSACAG00000015357   Transcript: ENSACAT00000015450
Sequence length 447
Comment pep:known_by_projection chromosome:AnoCar2.0:5:80672199:80704456:1 gene:ENSACAG00000015357 transcript:ENSACAT00000015450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFEDETLKLRQLKLENQRTLLEKKQRKKRLEHLMVQPNPEAKLCKLKSKVGEEQTPLVAC
SPSVPRDSTQIQHVGIDDPVASLNQVAQDQISVGSSITENYTDQEKRKEIQSDVVSKMDL
QDLLQKRGISGSLNFDEEDTEEEDVEKQSGSHSPELESQRSNSANSQHSAKEIDASTVAL
PQTDVQLGEIENLEEFVLRPAPCGVTVKCRITRDKKGMDRGLFPTYYMHLEREDDRKVFL
LAGRKRKKSKTSNYLISIDPTDLSREGGSFIGKLRSNLMGTKFTVYDHGVSPIKAQGLVE
KAHTRHEMAAICYETNVLGFKGPRKMSVIIPGMNPDHERIPIRREMEHESLLAKWQNKDM
DNLIELHNKAPIWNDDTQSYVLNFHGRVTQASVKNFQIVHENDPDYIVMQFGRVAEDIFT
LDFNYPMCALQAFAIGLSSFDSKLACE
Download sequence
Identical sequences G1KR31
ENSACAP00000015144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]