SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000015918 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSACAP00000015918
Domain Number - Region: 59-125
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0109
Family Formin homology 2 domain (FH2 domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000015918   Gene: ENSACAG00000016209   Transcript: ENSACAT00000016236
Sequence length 409
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343222.1:1950930:1952159:-1 gene:ENSACAG00000016209 transcript:ENSACAT00000016236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQIENFNHGNIHSFQGHRGVVNNNNNSKPNVILQIGKCRAEMLEHVRRTHRHLLTEVSKQ
VERELKGLQKSVGKLENNLEDHVPSAAENQRWKKSIKACLSRCQETIAHLERWVKREMNV
WKEVFFRLERWADRLESGGGKYCHADNPRQTVSVGVGGPEIRSSEGEIYDYALDMSQMYA
LTPPPTGEIPQPHESYQWVTAPEDVPPSPVETQIFEDPREFLTHLEDYLKQVGGTEEYWL
SQIQNHMNGPAKKWWEYKQDSVKNWLEFKKEFLQYSEGTLTRDAIKRELDLPQKEGEPLD
QFLWRKRDLYQTLYVEAEEEEVIEYVVGTLQPKLKRFLSHPYPKTLEQLIQRGKEVECNF
DNSADPSPQRTPEHQLGDSVEILPPSITASSAASDRTQPEVSIPPTTVI
Download sequence
Identical sequences H9GMZ9
ENSACAP00000015918 XP_008113705.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]