SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000016216 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000016216
Domain Number 1 Region: 581-590,631-999
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 1.7e-103
Family Formin homology 2 domain (FH2 domain) 0.0000302
Further Details:      
 
Domain Number 2 Region: 7-142,199-414
Classification Level Classification E-value
Superfamily ARM repeat 2.61e-95
Family Diap1 N-terninal region-like 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000016216   Gene: ENSACAG00000016489   Transcript: ENSACAT00000016539
Sequence length 1090
Comment pep:known_by_projection chromosome:AnoCar2.0:6:65313918:65408923:-1 gene:ENSACAG00000016489 transcript:ENSACAT00000016539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSAGELEERFSHVLNSMNLPPDKMKLLSQYDNEKKWELICDQERFQVKNPPSAYIQKLK
GYLDSGGFSGKAVIPILGRLALFKRRVQESTQVLRELEISLRTNYIGWVQEFLNEENKGL
DVLVDYLAFAQCSVTYDMDSTDNGSPGSDKGRPLDRSMEDLSRNSSPTQGSTKTRHFTVR
LNTAHSRKALRNSRIVSQKDDVHVCIMCLRAIMNYQSGFSLVMNHPACVNEITLSLNNKN
PRTKALVLELLAAVCLVRGGHDIILAAFDNFKEVCGEKNRFEKLMEYFRNEDSNIDFMVA
CMQFINIVVHSVENMNFRVFLQYEFTQLGLDEYLERLRYTESDKLQVQIQAYLDNIFDVG
ALLEDTETKNAVLEHVEDLQEEVGQLTEKLQDAENESLARVAELEKQLCQSRRELEALRA
RTTSDEQGPPLLQKQSSQGAGEPPLPSALERKLEELEDKGLIRILRGAGSDAITGIEIIP
VIVDTTAATTITIEAPSSTSTDVPSPSASPVPPAAPEIPPAPPLPLTQTTREEISLPPPP
SPPPAPPLPGGSEPPPAPPLPIAATGSHPPPPPPLPSVNGPAPPPPPPPPMVEGGQPNNA
SGKSGLIRNKALFQTVKIKKPIQTKFRMPIFNWVALKPNQVNGTVFNELNDEKVLQELDM
SHFEDQFKTRAQGPGREFGAVKVKVSQKASSKVTLIECNRAKNLAITLRKGGLPIDGICK
AIQTYDLQSLSLDFLELLMRFIPTEYELTTIRKYEKEQRPLDDLSDEDQFMIKFSKIPRL
TERMNIMTFLGNFGDTVQLLLPQLNAVIAASMSIKASTRLRQILEIVLAFGNYLNSSKRG
AAYGFRLQSLDALLDMKSTDRKQTLLHYIVRVIEEKYPDLISFSSELHFLDKAATVSLDS
VLQDVRGLQRGMELTRKEFMRQDDSAVLKEFLKTNTEVMEKLQADSKTAQEAYEATVEYF
GENPKTTPPTMFFPMFVRFIKAYKKKKAEDDIQLWKKQEAAAKEEEMDSSKKEEQVAAKS
PTHKAKRQQMDLIAELKKKQMVKEPLIYEEKDGAIEDIITALKTVPFTARTGKRSSRLFC
DASFNEESPL
Download sequence
Identical sequences G1KSN7
ENSACAP00000016216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]