SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000016258 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000016258
Domain Number 1 Region: 243-445
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.08e-48
Family Reprolysin-like 0.0021
Further Details:      
 
Domain Number 2 Region: 537-592
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000379
Family TSP-1 type 1 repeat 0.0004
Further Details:      
 
Domain Number 3 Region: 950-998
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000222
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 4 Region: 892-950
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000549
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 5 Region: 827-888
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000994
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000016258
Domain Number - Region: 5-15
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00314
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000016258   Gene: ENSACAG00000016472   Transcript: ENSACAT00000016582
Sequence length 1186
Comment pep:known_by_projection chromosome:AnoCar2.0:2:140656003:140956700:1 gene:ENSACAG00000016472 transcript:ENSACAT00000016582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGARPPPPPPPLPPPLAALLLAAACCWGCCCSSGDPALGDLEEYSLVIPISTNSEGRFLS
KVVSGASKQRFRRDTTAGDPAAGSQHIFYNVTVFGQEFHFRLRPNRRLVAPGATVEWQGE
DSNLTSVEPLRGDCLYVGDITDLPNASVAISNCDGLAGMIRTDKDEFFIEPLQKGKQEEE
EGRTHVVYRRAAAKKTLPSEHPDIQYRETDLSNLDSMVNVLKDEIDTSRRRRRYPRHAAD
DDYNIEVLLGVDDSVVQFHGKEHVQKYLLTLMNIVNEIYHDESLGAHINVVLVRIIMLSY
GKSMSLIEIGNPSQSLENVCRWAYLQQKPDTGHAEYHDHAIFLTRQDFGPSGMQGYAPVT
GMCHPVRSCTLNHEDGFSSAFVVAHETGHVLGMEHDGQGNRCGDEVRMGSIMAPLVQAAF
HRFHWSRCSQQELNRYLHSYDCLRDDPFDHDWPSLPQLPGIHYSMNEQCRFDFGLGYMMC
TAFRTFDPCKQLWCSHPDNPYFCKTKKGPPLDGTMCAPGKHCFKGHCIWLTPDILKQDGN
WGAWSKFGSCSRTCGTGVKYRTRQCDNPHPANGGRTCFGPSYEFQLCSTQDCPKDFEDFR
EEQCKQWDPYFEYQNMKHHWLPYEHNDAKERCHLYCESKETNDIVYMKRLVHDGTRCSYK
DSHSICVRGECLKVGCDKVIGSTKQEDKCGVCGGDNTHCKVVKGTFSRAPKKQGYIKMFE
IPAGARHLLIQESDATVHNLAIKNKETGKFILNEDNYVPDSKVFVNMGVEWDYRNDDDRE
MVQTMGPLRNGIIVLAIPHGNIKISLTYKYMIHEDSLNVDNNNVLEDSVTYEWALKKWSQ
CSKPCGGGHQFTKYGCRRKTDHKMVHRSYCDAIQKPKPIRRVCNLQECSQPIWVTGDWEP
CSKTCGKTGIQVRSVRCIQPLHDNTNRSVHTKYCSSDRPEGRRACNRELCPAQWRIGPWS
QCSVTCGNGTQDRQVLCRTRENLIGLCREEKPETTRLCKLPLCPKNSSDTSKKTYMIQWL
SRPDPDYPIQKISSKEHCQGDKSMFCRMEVLYRYCAIPGYNKLCCKSCNLYGNNTGNGNS
TESNHSKVNDIEEETTLTTLVDVHISHTTSGPTIVPKANITSSNTTVDQPEGNAVDVPYK
IHGLENEVPHHNIILRRKPPYERTKNQRIQELIAEKRKKEMLRKLL
Download sequence
Identical sequences G1KSQ7
XP_008103062.1.98722 ENSACAP00000016258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]