SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000016329 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000016329
Domain Number 1 Region: 489-606
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000222
Family F-box domain 0.0081
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000016329
Domain Number - Region: 59-67
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0994
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000016329   Gene: ENSACAG00000016611   Transcript: ENSACAT00000016653
Sequence length 623
Comment pep:known_by_projection contig::AAWZ02037989:1972:3984:-1 gene:ENSACAG00000016611 transcript:ENSACAT00000016653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQNTFSSRIQLWCPRPFGTYSQNKQCTGGQVKKTFGDFACKAKEEEVAGGEASSENIPP
APPPPPPATSLSPSQVEEGRVLLDTWYVIKPGNTKEKIAFFVAHQCSSGSRASAMKVKGN
WGSDSSKAKRRRRSHDPSKSRPCPESHTDPASADTTDLLSVAEMVALVEQRTALALQNYA
RPSPPAAPPSPMVFVSTEQEESGEKKGGTLGGGGSDCSRVAEAVAHFESRERNVLRQNGL
CRESPECVANSQHSPGEVRIAFRISSSRDPRSPTEGGSSTRPNCMFMSCGGSPTGSAARA
KDKITCDLYQLISPSRDTLPNNVDFLLASASPKGADGSGSDPPDVEMTGPSAATTITRDC
ISGFHVDVVVTGVVDQCVFFGKDSTKNMKEETVCLTVSSPTQEVLCSSCDDPPPGQLFFL
HTQGGQPGDSRDMDGAFLDPMNGSEGGLDRADGSGLESSGSDTSLCRLYRHVSHDFLEIR
FKIQRLLEPRQYMLLLPDHIMVKIFSYLPTQSLAALKCSCHYFKYIIETFGVQATDSKWN
RDPLYRDDPCKQCKKHYEKGDVSLCRWHPKPYHHDLPYGRSYWMCCRRTDKDTPGCRVGL
HDNNWVQPCDMLRERAARREDGR
Download sequence
Identical sequences H9GNE2
ENSACAP00000016329 ENSACAP00000016329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]