SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000016484 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSACAP00000016484
Domain Number - Region: 455-465,525-530
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0212
Family Formin homology 2 domain (FH2 domain) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000016484   Gene: ENSACAG00000016753   Transcript: ENSACAT00000016810
Sequence length 610
Comment pep:known_by_projection chromosome:AnoCar2.0:2:12905790:12937861:-1 gene:ENSACAG00000016753 transcript:ENSACAT00000016810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLEKHKNTESMVELLELYQLEDEAYSSLAEATTELYQYLLQPFRDMRELAMLRRQQIKI
SIENDYLGPRRIESLQKEDADWQRKAHMAVLSIQDLTVKYFEITAKAQKAVCDRMRADQK
KFGKAAWAVAVERMEKLQYAVSKETLQLMRAKEICLEQKKHALKEEMQSLQGGTEAIAHL
DQLEADYYDLQLQLYEVQFEILKCEELLLTAQLESIKRLISEKRDEVVYYDTYESMEAML
EKEDMAASIHLQREELQKLQQKVRQLEARRGRISAKKAYLRNKKEICIAKNSEKFLQHFQ
TEEESQHTAISQKRERLQAEEERKSSWVSQERQKTLDRLRTFKQERKNASSSHRVGLLPS
SQTDFLVLLMGQLKQSIKSTFFVTKLRLAHARKKSTACSTPCADQSLSSPVTMQTENLGE
EKLIQPLLTQEPRSLGQLEDTFLPPPDTVQEAPLPPPLPPPPPPPLPIKEESTQCADKST
SPIKQDSMEKPSLLNTIAPSVKRKSQTKISSPMDEVLASLKRGSFHLRKVEQRNLPPFPD
EDDSNNILAQIRKGVKLKKVQKDIMRESFTILPDDDPLTRSIHEALRRIKEASPESEDEE
ENLPCTDWEN
Download sequence
Identical sequences G1KT19
ENSACAP00000016484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]