SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000016546 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000016546
Domain Number 1 Region: 52-337
Classification Level Classification E-value
Superfamily Aldolase 3.37e-70
Family HMGL-like 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000016546
Domain Number - Region: 28-36
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0785
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000016546   Gene: ENSACAG00000016794   Transcript: ENSACAT00000016872
Sequence length 347
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343342.1:588573:673180:-1 gene:ENSACAG00000016794 transcript:ENSACAT00000016872 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNVPSALKHCLSYQHLLKEPLWVGDAPPPPPSPPPTEDPQPLGQELLTSGFPEFVKIVE
VGPRDGLQNEKAIVPTDVKIEFINRLSKTGLPVIEVTSFVSSKWVPQMADHTEVMGRIQR
YPGVQYPVLTPNLHGFHSAIAAGANEVSVFGAASEAFSKKNINCSIEESMERFENVVKSA
RNMDIPVRGYVSCALGCPYEGSIAPAKVAQVSKRLYSMGCYEISLGDTIGVGTPGSMRRM
LESVMKEIPVTAIAVHCHDTYGQALANILTALQMGVHVVSLQCCLGGCPYAKGATGNVAT
EDVIYMLNGLGINTGVNLYKVMEAGNFICTALNKNTNSKVAQASFCG
Download sequence
Identical sequences H9GNM2
ENSACAP00000016546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]