SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000016873 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000016873
Domain Number 1 Region: 649-704
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000444
Family SAM (sterile alpha motif) domain 0.015
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000016873
Domain Number - Region: 540-616
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.00788
Family Carboxylesterase 0.06
Further Details:      
 
Domain Number - Region: 341-372
Classification Level Classification E-value
Superfamily WWE domain 0.0314
Family WWE domain 0.011
Further Details:      
 
Domain Number - Region: 45-53,329-344
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0392
Family Formin homology 2 domain (FH2 domain) 0.044
Further Details:      
 
Domain Number - Region: 265-328
Classification Level Classification E-value
Superfamily WWE domain 0.0432
Family WWE domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000016873   Gene: ENSACAG00000017131   Transcript: ENSACAT00000017208
Sequence length 1010
Comment pep:known_by_projection chromosome:AnoCar2.0:3:66131015:66170633:-1 gene:ENSACAG00000017131 transcript:ENSACAT00000017208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPKASVAAGGLSSAANSGTNLLFSSSATEFNFTVPFIPVSQAPAPPPPPPPGLLPSDD
ATDVGEEDSFLGQTSANPNPPPTFNYFSQVPSSSDPFGSIGQSPLGVTSPPQSGMSVFSK
PPVSLPLLPGSQDGPSTFSAALSKSQSFNTPPTSLQGIGSYQMSQQSGPPAAGFSTPPHG
TSQQSYNPYRHTTISSRANPYITPPQLQQSQPPTQSIQPSPPVPPTQMYSTPPGSLPPST
LPPQASMSAGALVKAPPNFLQNQYEPLQPHWFYCKEVENKELWMPFSLLDSAALEEVYNS
VQPDPENVLLSTDGGRYDVYLYDRVRKAVYWEEEQSEVRRCTWFYKGDTDSRFIPYTEDF
SEKLEVEYKKAVTTNQWHRRLEFPGGETIVMHNPKVIVQFQPSAMPDEWGTTQDGQTRPR
VVKRGIDEDHEEIPDGEVSQVDHLVFMVHGIGPVCDLRFRSIVECVDDFRTVSLKLLQTH
FRKSLEEHKVNRIEFLPVHWHSALHGDATGVDRNIKKITLPTIGRLRHFTNETLLDILFY
NSPTYCQTIVDKVGLEMNRLYALFMSRNPDFKGAVSVAGHSLGSLVLFDMLSNQKDWTST
VNSVAPVAPNGIVKDVAEQQMTVDSNPAGSIPSLSNDDHGDHDVEDDIPTLQRTLEMLSL
SEYISTFENEKIDAESLLMCTIDDLKEMGIPLGPRKKIANFVKDRAAKQEQKKAALEKKA
AMDALIRNQEEAAQATKKVARLAASSAMVMPQDPSKRRLSVGTSVSSAHIDYEYFEVGTG
QVSVVYTTLDFEPEIFFALGSPIGIFLTVRGVERIDENYRFPTCKGFFNIYHPLDPVAYR
LEPMIIPDLDIKPVLIPHHKGRKRLHLELKESLSRMGSDLKQGFISSLKSAWQTLNDFAR
AHTSSIQLQAELEKVANQIKEEEEKHETEAEKIVESPDFSKDEDLSIKIGLLNGGRRIDY
VLQEKPIESFNEYLFALQSHLCYWESEDTALLLLKEIYRTMNIYPEQPQH
Download sequence
Identical sequences G1KTK5
XP_008104995.1.98722 XP_008104996.1.98722 ENSACAP00000016873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]