SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000016893 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000016893
Domain Number 1 Region: 73-225
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 1.57e-51
Family Troponin I 0.00000213
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000016893
Domain Number - Region: 38-45
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0994
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000016893   Gene: ENSACAG00000017150   Transcript: ENSACAT00000017228
Sequence length 250
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343355.1:850179:858077:-1 gene:ENSACAG00000017150 transcript:ENSACAT00000017228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCYLFLQYEEEVEEEEYVEEETEETVVETKPQVPPSKPTPPPPPPATVPPLRRKSSANYR
AYAVEPHDKRKSKISASRKLQLKSLMLQVAKHEMEKEEEERVQEKERYLSDRCTPLELAG
LGLKELQEMCRQLHRQVDKMDEERYDMEARVSKSVNEIKDLNQKIFDLRGKFKRPALRRV
RLSADAMMQALLGTKHKVSMDLRANLKQVKKDDTEKQENREVGDWRKNIDALSGMEGRKK
KFEASPAGQA
Download sequence
Identical sequences H9GP12
ENSACAP00000016893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]