SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000016973 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000016973
Domain Number 1 Region: 369-629
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 1.31e-108
Family Transcriptional factor tubby, C-terminal domain 0.00000000296
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000016973   Gene: ENSACAG00000017252   Transcript: ENSACAT00000017308
Sequence length 629
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343355.1:541082:563083:-1 gene:ENSACAG00000017252 transcript:ENSACAT00000017308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQFCLKGPILPLLLLIYFCSCMESPNTNPSPIPGSNGNDEAAFIRKQKLEFQRRIIEKK
QRRKRQEPLMVQANTDAKVKGRCGRRKPEERIPLMESCSEHSLYNSTNNPYLVESVPEAH
LGAHMWGNSVQMNRAQNHGQGENQELSPVDFSDESELEVAVLEETQPINKNETAPKNGWQ
AKQKEGRPSAQRRNQASKSKRTVLSPRQSTPSAMEDVEAKSPRYRPKTQKPRKKVLSPIP
KVPADMEVFKNDSYTEEVESIDSKATTEERCDVLRVPSSSESEGESSQELSLSSSALKKS
RNWMLSHRGSLTNGRRSQSDEEEDEDYEDEEKKEDFNSEEQDILERVMYIREEVNLSSSP
SGESSTPLSLKVDDVEEFVLKPAPKGNIIQCRITRDRKGMDKGIFPFYYLHLEMENGKKH
FLMSGRKRKKSKTSNYLISLDPIDLSRDGDNFIGKVRSNVLGTKFTVFDNGINPDKKPFV
PETADLRQELVAICYETNVLGFRGPRKMTVIIPGINTDNERICIRPKNEHETLLTRYQNR
NMQNLIKLQNKMPAWNEETQSYVLNFHGRVTQASVKNFQIIAEDNPDYIVLQFGRVASNV
FTMDYQFPLCALQAFAICLSSFDGKLACE
Download sequence
Identical sequences H9GP51
ENSACAP00000016973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]