SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000017011 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000017011
Domain Number 1 Region: 42-171
Classification Level Classification E-value
Superfamily Bromodomain 1.96e-44
Family Bromodomain 0.00015
Further Details:      
 
Domain Number 2 Region: 331-468
Classification Level Classification E-value
Superfamily Bromodomain 1.22e-40
Family Bromodomain 0.00029
Further Details:      
 
Domain Number 3 Region: 252-259
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000366
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000017011   Gene: ENSACAG00000017270   Transcript: ENSACAT00000017346
Sequence length 1345
Comment pep:known_by_projection chromosome:AnoCar2.0:2:103323245:103378309:-1 gene:ENSACAG00000017270 transcript:ENSACAT00000017346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTESSPGTRLRNLPVMGDGLEATQMSTTQAQAQPQQGNTLSTNPSPPETSNPNKPKRMT
NQLQYLLKVVLKTLWKHQFSWPFQQPVDAVKLQLPDYYKIIKTPMDMGTIKKRLENNYYW
NAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKISEMTQEETEIVIVQTKGRG
RGRKETVTSKAGASAVQNTTQTSSPSQTPAPQQNPQPAQTTHSFPSMTPDLIVQTPVMTV
VPAQPPAPPPPPPPPPPPPPPPPASAPQPIQTHPPIIPTAAQPMKTKKGVKRKADTTTPT
TIDPVHESSSLPAEPKPAKAGPRRESRPVKPPKKDVPDSQQHVVEKSSSNKVSEQLKYCS
GIIKEMFAKKHAAYAWPFYKPVDVEALGLHDYRDIIKHPMDLSTIKSKLENRDYRDAQEF
AADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPEEPVIPASSPVAVQPPP
KVPPPSSSDSSSDSSSDSDSSSDDSEEERAQRLAELQEQLKAVHEQLAALSQPQQNKPKK
KEKDKKEKKKEKHKKKDEVEENKKNKTKDPLPKKAKKNNGNNTNSSSKKEPVTVKNAKPA
PVYESEEEEKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDF
ETLKASTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSSSESESTSESSSSDSED
SETEIPPKLRKKGHTGREQKKHHHHHHQQVQQQPQPPPQQQLQPQQLPPPSTAVPPQTVA
SVKSSPPAFVPAQIPIMEHPLPGNMFDSISHFTQPIMQLPPPEMPPHIPQQPEHSTPPHL
NQHTVVSPPALHNALPQQPSRPSNRAAALPLKPSRPPAVSPALNQQPMLPQPPLPQPPQV
LLEDEEPPAPHHTLPLSNSQMQLYLQQLHKVQPQTSLLPSVKVQSQPQPSLQPSHPPVQQ
LQHQPQPRPVHMQPMQFASHMPQPQPPPQQHLPPQQPQQPPQQPPKPQQVIQHHPSPRHH
KPDLYSTGHLREAPSPLMMHSPQMPQFQGLPHQSPPQPNVQPKKQELRAASVVQSQPMVK
EEKMQSPVIRNETFSPALRQDPPKHPESIKPPTHVQQRTEMKPVDGGRPVIRPPEQNAPP
GVQEKERQKQEPKTPVAPKKDLKIKNMGSWASLVQKHPTAPSSTAKSSSDSFEHFRRAAR
EKEEREKALKAQAEQAEKEKERQRREQERMRSREEEDALEQARRVHEEVRRRQEQQQQQQ
QQQPQHQPPPPPPPQQPQPPPQVSATASAPQAQSSQPHTSQSMLDQQREMLRKREQERRR
REAMAATIDMNFQSDLLAIFEENLF
Download sequence
Identical sequences G1KTQ0
ENSACAP00000017011 XP_008102453.1.98722 XP_016846771.1.98722 XP_016846772.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]