SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000017270 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000017270
Domain Number 1 Region: 1433-1626
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.64e-25
Family Extended AAA-ATPase domain 0.021
Further Details:      
 
Domain Number 2 Region: 2340-2482,2513-2634
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.88e-23
Family Extended AAA-ATPase domain 0.057
Further Details:      
 
Domain Number 3 Region: 2027-2300
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.77e-22
Family Extended AAA-ATPase domain 0.092
Further Details:      
 
Domain Number 4 Region: 1646-1858
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000687
Family Nitrogenase iron protein-like 0.076
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000017270
Domain Number - Region: 889-1011
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0327
Family Formin homology 2 domain (FH2 domain) 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000017270   Gene: ENSACAG00000017460   Transcript: ENSACAT00000017610
Sequence length 4055
Comment pep:known_by_projection chromosome:AnoCar2.0:2:103777495:104067911:1 gene:ENSACAG00000017460 transcript:ENSACAT00000017610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFAQLDNFLERLQVVHDLLTTVLDIEKLEKLEFSGIKGKFLSQQVLGMHEEFQEAYKVF
SESTYDCLDIANLEFEEDVYEFKWKIEDMDRRLGTIFGQAYDDAASVEHVFKIIDIFGSL
LERPLIAAEAGSKYHLLITKFDRELDDAKLIYLKHIQEKVQLGYPPVHRNMPLVAGGIHW
TRELKDRIQIPFSNFKYLPHLDLDSAEGKRMVKKYEELMQLLEKYQEKLYKEWLQTVSEK
SQYSLTQSLIRRDPESRQIAVNFNPQLVSVLREVKYLGTDEFGNIPEMAAAIYSSKESFR
QLVANLELMVTWYNKILSTVLEVEYLLVQSQLQAIDIQLREAEETLNWKSEGLWDRVLPM
VDSVRDLEQRIQKTKDNIEEIQNIMKTWVFPVFERKDGKKESLLYLDERHERLDRHYQLI
TDSGHKIHFLIKENLRLFAADPASDVWTAYLEHVDEMVLDGFFNVIERSLKYLLENTDPK
AGLAPLFKVQLDLSVPEMVFHPSLDAGASDSFYDLVEALVNDIFRVSSLMPRLVEHSTFP
HYQADMEEMADLADMRHTLMDRIQKMISVCSDYRSSFDHYSYLYVDDKKEFLHQFLLYGH
VLPTEEIELHAENGIPESPPTLQQFKEQIDSYQKIYMDVSLLEPVSIFDSWMKVDARPFK
ASLLGIIKKWSFMLKQHLVDHVTQSLADLEEFIKVAERGLSKEVEKGDYEGLVEVMGHLL
AVKDRQTSTDEMFEPLKQTIELLKAYEQELPLEAYRQLEELPEKWNHVKKLAITAKHHVA
PLQANEVTVLRKKCAVFDVEQQKFRERFHKEAPFRFDAANPYQMLAAAHTELQEMEVTMA
SIHESAALFEVGVPDYKQLKQCRKEVLILKELWDVISIVTSSMNEWETTKWKDINIENME
LECKRFAKGIRNLDKETRAWDAFSGLENKVKNILTSLKAISELQNPAIRERHWNQLMQAT
GVQFIMDADTTLADLLKLNLHNFEDEVRSIVDKAIKEMSMEKVVKEIKTTWAGMTFQYEP
HLRTNVPLLKSDEELIETLEDNQVQLQNMMTSKYIAFFLEEVSFWQRKLSTADLVISIWF
EVQRTWSHLESIFIGSEDIRAQLPEDSKRFEGIDVDFKELAYDAEKTPNVVEATNKSGLY
EKLEDIQNRLSLCEKALAEYLDTKRLAFPRFYFISSADLLDILSNGTNPQLVQRHLSKLF
DNMAKMKFQVESDQIPTKLGLGMYSKEEEYVDFSEPCDCSGQVESWLNRVLDHMRATVRH
EMTEAMMAYEEKAREQWLFDYPAQVALTCTQIWWTTEIGISFARLEEGYENAMKEYYKKQ
VTQLNTLITMLIGHLSKGDRQKIMTICTIDVHARDVVAKMIAQKVDNAQVFLWLSQLRHR
WADEEKHCYANICDAQFLYSYEYLGNTPRLVITPLTDRRCYITLTQSLHLTMSGAPAGPA
GTGKTETTKDLGRALGIMVYVFNCSEQMDYKSCGNIYKGLSQTGAWGCFDEFNRISVEVL
SVVAVQVKSIQDAIRDKRQNFNFLGEDIKLVPSVGIFITMNPGYAGRTELPENLKALFRP
CAMVVPDFELICEIMLVAEGFIEARLLARKFITLYQLCKELLSKQDHYDWGLRAIKSVLV
VAGSLKRGDPDRPEDQVLMRSLRDFNVPKIVTDDMPVFMGLIGDLFPALDVPRKRDLSFE
SFVKQAVLHLKLQPEDNFVLKVVQLEELLAVRHSVFVVGSAGTGKSQVLKSLNKTYHIMK
RRPVWTDLNPKAVTNDELFGIINPATREWKDGLFSSIMRDLANVTHEGPKWIVLDGDIDP
MWIESLNTVMDDNKVLTLASNERIPLNPTMRLLFEISHLRTATPATVSRAGILYINPADL
GWNPPVSSWIDGREIQSERANMTILFDKYLPVCLDTLRTRFKKIIPVPEQSMVQMLCYLL
ECLLTREATPPDSPKELYELYFVFAAVWAFGGALFQDQLVDYRVEFSKWWVTEFKTIKFP
SQGTVFDFYIDPETKKFELWSKLIPKFEFDPEMPLQACLVHTSETIRVRYFMDRLLERRR
PVMLVGNAGSGKSVIVGDKLSLLDSEEYLVKNVPFNYYTTSAMLQAVLENSLEKKAGRNY
GPPGTKKLIYFIDDMNMPEVDTYGTVQPHTLIRQHLDYGHWQRYDRNKLSLKEIMNVQYV
SCMNPTAGSFTINPRLQRHFSVFALSFPGSDSLSTIYSTILTQHLKWENFPGAVQKSSQQ
LINLALALHLKVAAMFLPTAVKFHYNFNLRDLSNIFQGIIFSTPECLKTPQDLVKLYMHE
SCRVYRDKMVDEKDFAAFDKMQTEIVKKFYDEIEETLEQTKKMNMFCHFAKGVGEPKYMP
VQCWESLNQILVEALENHNEVNAAMNLVLFEDAMSHICRINRILESPRGNALLVGVGGSG
KQSLTRLAAFISSLEVFQITLRKGYGIPDLKADLASQYITAGVKNMGTVFVMTDAQVADE
RFLVLVNDLLASGEIPDLFPDDEVENIISNMRNEVKAQGLVDSREACWKFFIDRVRRQLK
VALCFSPVGNKLRVRSRKFPAIVNCTAIDWFHEWPREALESVSLRFLEGTETIETSVKES
ISKFMAFVHTSVNEMSHSYLSNERRYNYTTPKSFLEQIKLYQNLLFKKGKELTARMDRLE
NGLQKLRSTSAQVDDLKAKLAAQEVELKQKNEAADNLIQVVGIETEKVSKEKAIADDEEQ
KVAQITQEVQQKQRDCEEDLEKAEPALAAAEEALKTLNKNNLTELKSFGSPPSMVSNVTA
AVMVLMAPDGKVPKDRSWKAARVAMSKVDGFLDSLIHFNKENIHENCLRALQPYLQDEKF
NPELVKLKSQAAAGLCSWVINIVRFYEVYCDVEPKRQALSKANAELAAAQEKLASIKAKI
AHLNENLARLTAKFEIATAEKVKCQKEAEATANIISLANRLVGGLASENVRWAESVKDFK
LQESALCGDVLLITAFVSYLGYFSKKFRQDLMDSVWKPYLNQLKVAIPITPSLDPLRMLT
DDADIAAWQNEGLPADRMSTENATILTNCERWPLMVDPQLQGIKWIKAKYGEDLRVTRIG
QKGYLDLVEQALAAGEVVLIENLADTVDYICLGILGYVASKTAYISIKNKECILPLFYRI
CTHYSLITSHRPRHLGSVRRVIQYKKIQPGMRNFFLYTVVYLLRVELNSSQSDLTKQQNG
FKITLKTLEDNLLSRLSSASGNFLGDTALVENLEVTKQTAAEIEEKVQESKVTETKINEA
REHYRPAAARASLLYFIMNELNTIHPMYQFSLKAFSAVFQKAVARATPDENLPERVANLI
DSITSSVFQYTTRGLFECDKLTYMTQVTFQILLMNKEINAMELDFLLRYPAQPGVTSPVD
FLSSQSWGGIKALSSMEQFHNLDRDIEGSAKRWKKLVESECPEKEKFPQEWKNTSALQQL
CMMRALRPDRMTYAVRDFVEEKLGSKYVLGRSLDFATSFEESGPTIPMFFILSPGVDPLK
DVEKHGKKLGYTFNNRNFHNVSLGQGQEVVAEQALDLAAAEGHWVILQNIHLVAKWLSSL
EKKLEQHSEGGHPEFRVFISAEPAASPEGHIIPQGILENSIKITNEPPTGMHANLHKALD
NFNQDTLEMCSRENEFKSILFALCYFHAVVAERRKFGPQGWNRSYPFNTGDLTISVNVLY
NYLEASSKVPYDDLRYLFGEIMYGGHITDDWDRRLCKTYLEEFIKPEMLEGEFLLAPGFP
LPGNMDYNSYHQYIDDTLPAESPYLYGLHPNAEIGFLTQTSEKLFRTVLELQPRDTSLGE
GGGATREEKVKTLLDDILEKLTDEFNIPELMAKMEERTPYIVVAFQECERMNFLTSEIRR
SLKELDLGLKGELTMTSDMENLQNAIFLDTVPESWTKRAYPSMAGLGSWFADLLNRIKEL
ETWTGDFMLPSAVWLAGFFNPQSFLTAIMQSTARKNEWPLDKMTLHCDVSKRNREDFTST
PREGACVHGLFMEGARWDMQLGLIAEARLKDLTPPMPIIFIKAIPVDKQDTRNVYPCPVY
KTRQRGPTYVWTFNLKTKEKPSKWVLAGVALLLQI
Download sequence
Identical sequences G1KU34
ENSACAP00000017270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]