SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000018540 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000018540
Domain Number 1 Region: 28-124
Classification Level Classification E-value
Superfamily PDZ domain-like 1.13e-17
Family PDZ domain 0.0000178
Further Details:      
 
Domain Number 2 Region: 1116-1182
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.86e-16
Family SAM (sterile alpha motif) domain 0.00012
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000018540
Domain Number - Region: 302-356
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0889
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000018540   Gene: ENSACAG00000000095   Transcript: ENSACAT00000027586
Sequence length 1184
Comment pep:novel scaffold:AnoCar2.0:GL343837.1:74615:166283:-1 gene:ENSACAG00000000095 transcript:ENSACAT00000027586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLTPPPLPPLPPSSFILFCSFLPSDYIIEEKAAVLQKREHEGFGFVLRGAKAETPIEEF
TPTPAFPALQYLESVDVEGVAWRAGLRTGDFLIEVNGVNVVKVGHKQVVSLIRQGGNHLV
MKVVSVSRKPESEDVVRKKAPPPPKRAPSTTLTLRSKSMTAELEELDLFMLDKSGVSDFA
EKLDEILAAAEPSLRADIVEADSRAATVKQRPTSRRITPAEISSLFERQGMAHGGPEKPH
VSLRKGIPRTKSVDSHLLLSSVTGEDEKFAASLMDGKFPRSTSMQDTVREGHGIPPPPQT
APPPPPSPYYFDTAPPPSFSPPPPPGRVYDTIRSSFKPGLEAKLHGLPQVISAAEMKRAR
SMIILQDSSHLPVEPTDIPRPGPSATPPEKLKRKGRGAVDNPYANMGQFNVSLFAPTKPQ
RKKSPLVKQLQVEDAQERAALSMAAAGGFVREPSPTRHSHRLGGMEYQSHHQQQPMDAGS
LPFATAIAGALKDRDRRLDERRKSTVFLSVGAIEGSPPTIEMPSLQQSRSIDERVLGSRD
VLLPSPVSALKPLISSSSSTFIHPLTGKPLDPNSPLALALAARERALSTQVPSRVPTPIH
SPDSDRTAPLFVDIQTKDQTPSALTPTQSHWGMPMITRKEGEVRAETPVKEERKAEDRKS
MIISIVDTSLQKTAGLIMVHATSNGQDLGLDMKEDKVPVPEGGPEPAELSATEAQPSPIG
KAPVSPASDKTLGQGSSEEEAEPYTVTLPPAQLSSSDEETREELAKIGLVPPPDEFANGV
LVTTPGTPISQLAAPAVATPSLPAAAVASSTTGGTPSGKPSDAPTAPESAADSGVEEVDT
RSSSDHHLETTSTISTVSSMSTLSSESGEPTDTYTSFADGQTFILEKPPVPPKPKLKSQL
SKGPVTFRDPLLKQSSDSELIAQQHAAILASASVGRPRYLFQRRSKLWGDPLDSRPIHGA
EDDKPTVISELSSRLQQLNKDTRSLGEEPAGTVLDPGKKSPVVAARSLGELSTISQRSSG
TTYTVRPGSRYPVTRRTPSPVKPAALDRTDPLSPVRPYGLTPPTILKSSSLSIPHEPKEV
RFVVRSVSARSRSPSPSPSPSPALHALHPPRPFMQKPLHLWNKYDVGDWLESINLVEHRD
KFEDHEIEGTHLPALTKEDFVELGVTRVGHRMNIERALKQLVDS
Download sequence
Identical sequences H9GR24
ENSACAP00000018540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]