SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000019201 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000019201
Domain Number 1 Region: 358-494
Classification Level Classification E-value
Superfamily Cyclin-like 1.13e-20
Family Cyclin 0.018
Further Details:      
 
Domain Number 2 Region: 69-78
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000968
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000019201   Gene: ENSACAG00000005032   Transcript: ENSACAT00000028699
Sequence length 512
Comment pep:known_by_projection chromosome:AnoCar2.0:4:151285203:151346104:-1 gene:ENSACAG00000005032 transcript:ENSACAT00000028699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAAACGGSPSKEQPEPPPASRKRGGDPRRRQAALFFLNNISLDGRPPCLGAPGKAQE
QPPPPLPSPPPPPPPPPPTQPEDKAAATESGLLLPSAAEQDPGRGLGPALLPQLLLGSPL
CPIPAPAPAAAAAAAGALAGMLMGAAAGKAPQGLLSPGTQSSSSAGAGGGIPLEIQRQRT
KHLSGSPRHKGLKKMHFIKNMRQYDTRNSRIVLICAKRTLCVAFSILPYGESLRISELRI
EGQKQRHPSGGVSVSSEMVLGMEGVELGADGKVVSYARFLYPTNALVGRKNEAHGAIPVC
RAPLPRGPGSSRYKTPTAKTIPPTVDIGNDIGELIEYNPNLLDDPQWPCGKHKRVLIFAS
YMTTVIEYVKPSDLKKDMNETFKEKFPHIKLTLSKIRSLKREMRNLSMECNLEPVTVSMA
YVYFEKLVLQGKLNKQNRKLCAGACVLLAAKISSDLRKHEVKHLIDKLEERFRFNRRDLI
AFEFTVLVALELALYLPDNQMLPHFRRLTQQS
Download sequence
Identical sequences G1KWB2
ENSACAP00000019201 XP_016848952.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]