SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000019438 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000019438
Domain Number 1 Region: 609-620,695-1063
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 1.7e-70
Family Formin homology 2 domain (FH2 domain) 0.000078
Further Details:      
 
Domain Number 2 Region: 140-218
Classification Level Classification E-value
Superfamily PDZ domain-like 2.66e-22
Family PDZ domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000019438   Gene: ENSACAG00000013844   Transcript: ENSACAT00000023111
Sequence length 1074
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343827.1:101698:159568:1 gene:ENSACAG00000013844 transcript:ENSACAT00000023111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLPQVQEILGDEPELKEKMFTILKQFAAERKVDDLAYALAMLFTKDSHRLLIDNIRIFIP
RKHRQRFDEVVSQSLISKLCRSKSGHPGGRLRRSRSEDPRERLLVSTRASSVPRSHEESL
KGLRQASSLVASNVGSGAARRTVRVYKGSRSFGFTLRGHAPVWIESVLPGSPADKASLKA
GDRILFLNGLDMRNCSHEKVVSMLQGSGAMPTLVVEEGIVSFSDSESTECPSSSSALTSL
QWVAEILPSSIKIQGRTFHQQLEHLLTPPERYAICKALESFFQHRNIDTLIVDIYPVLDT
PSKQVIWQFIYQLLTYEEQEHCQEKIARFLGYKSAAGKSTGELQGPNEQPAEPEVEEGLR
MGPSMSRRSLHGHNREEGGGGGAGGGIDVAVDLPVRVAPGERQAGDGTSLPETPNPKMMS
AVYAELETRLTTGFGGKLGNLAAHRTSPPEQGNPAGLRRSGPSISWQEGHPGYFQAPGAS
GGLPSPGSTESNPYVSLDSSPAPSPEQGLSPASQRHPHKKLFTFSRPPRSRDTDRFLDAL
SEQLGHRIALVDDLTPETTTRKMSFQDDQGSFITQDLSSASEDQSSSSSSEGSSEGSSLT
YSSLSDPIPPPPLSPPPPPPHPQDHKKGAQRRSQVGKAPLVAPSVSSSSSAAPNPGFRGP
QNPLPPVIKELGETLRLGLRYGQAFAHQCSHKKQRGIQKCQKSLVTIWQLGEDSDYDKLS
DMVKYLDLELHFGTQKPAKPNPLPESFKKKDVVEILSHKKAYNTAILIAHLKLSHLELRQ
ILLTMESDRLEPSHIKQLLLYAPDAEEVQRYHSYQGNPSKLSEPDQFVLQPNMASAPRPI
RSFHDGRKGREKGEELRTQRECYKQKFLPIGYYLHMIPCLQFVLAMGNYLNHGQPKANKT
TGFKINFLTELNTTKTVDGKSTFLHILAKSLGQHFPELLGFAKDLPTVPLAASFASVNQR
TLMADLNDLRTTVEEIEEACQNMVLSPEDRFTTVMDAFLETAHPTIQALEDLQSKAMEEF
TKVLSFFGEDAKATTSEAFFGIFAEFMSKFERAFSDIQTGEAQPSLRVTPPLAW
Download sequence
Identical sequences H9GSG7
ENSACAP00000019438 ENSACAP00000013570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]