SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000019615 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSACAP00000019615
Domain Number - Region: 22-29,116-149
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00288
Family Formin homology 2 domain (FH2 domain) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000019615   Gene: ENSACAG00000024584   Transcript: ENSACAT00000026091
Sequence length 271
Comment pep:novel scaffold:AnoCar2.0:GL344095.1:46797:78347:-1 gene:ENSACAG00000024584 transcript:ENSACAT00000026091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGAGAQARAGPGPGPSGDSEPPPPPPPPSSSSQPMISVDLAGLVSQFARSFALVFPVYV
LGYLGLSFSWILLALLGLFWVQRHRGGKASRLGRALAFLQDEERAVKLTVATGDLPAWVH
FPDTERAEWLNKTVKHMWPFICQFIEKLFRETIEPAVRGANNHLSTFSFTKIDIGHQPLR
INGVKVYTENVDKRQIILDLQISFVGNCEIDLEIKRYFCRAGVKSIQIHGTMRVILEPLL
GDMPLIGALSLFFLRKPVSEKSLYFLPSLRL
Download sequence
Identical sequences H9GSR7
ENSACAP00000019615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]