SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000019737 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000019737
Domain Number 1 Region: 65-471
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 1.96e-102
Family Formin homology 2 domain (FH2 domain) 0.0000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000019737   Gene: ENSACAG00000015978   Transcript: ENSACAT00000027076
Sequence length 1124
Comment pep:known_by_projection chromosome:AnoCar2.0:5:131352434:131411240:-1 gene:ENSACAG00000015978 transcript:ENSACAT00000027076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHVMNCVSLVNDKENGAISVEAGLMTGDTSEPEEQLTQPPPPPPPPLPLPCLSTEVGLSS
PATVPPPPPPPPPSLSKPSFSQLVNGHGHSSKKKRIRSFFWKTIPEEQVRGKNNIWTIGA
KQNYQIDTKTIEEFFGQPDGKAPLDSKSKALRRSFKDTKQEINILDAKRSMNIGIFLKQF
KKSFESIIGDLHSGRCDMYSCEVLRELLKLLPETEEVKKLKDFSGDISKLGQADSFMHLL
IQVPNYSLRLEAMVLKKEFSPSCSSLQKDMTIIRMATKELMCCEELHSILHLVLQAGNIM
NAGGYAGNAVGFKLSSLLKLADTKANRPGMNLLHFVALEAQKKDKVLLNFAEKLPHVHEA
ARISLESIEAELHSLSTKTKSLKENIRRDPELHHQMEGFLQFAVKELKELEHWKRDLLKE
AHALMDFLCEDKETMKLDECFQIFRDFCLRFSKAIKENKEREAHELQQLQRLKELEEKRQ
SWVAGDLGAFGRSSSESDVGTLTKRGLEEFLPFLQHRPQSPSYRNASIRRSRHSLGITAD
RELLTFLETSKGEDPNKSNSLPRAHACQTRATVAWIESKEPGDPNVTDLHLNQASEEHMG
CSYFPSPPPQSDRIDDLEVLDGAHANFCNNEDGAGNDNYNVPCMEAADTPPWDVSYEESE
FVPGLQKFDFSEVNDMDDPSEVNFEVGAGDLETMDDSSLCHLDPATRPVPAYRKSKEAPH
KDEQATKGARYANEAPRPSINSPSSSGNISGIKAQRPGFGVSDISDHSLTLDQSEENNPK
LGVNKVNRNNGAMAPLMSNVQTDDGLSSFSNDKEDSGSKPGLPKEKSGKGKDGFGPKRNS
LKEKSPGTTKPATNPPNHPRPVRTLNTSENASMRKVVPISRSTKAAPPTCTKKPEPKPAP
RDTSVAETRLSRRNSIRGITDVVPKPQYRQSISVEESKFQRGTAASSSGHFEREPLQQKG
SFKKPSSKPVRYIPKSKNDETKMCRSVPKPPSPTEVKSTTVAAPKTPAPVPSFARNTVAS
SSKCTKVDLPPATKAPALTRSLSQRLPRMRITAASDDANPKENGGSTLKRANSARMIKRN
TDSSELLSVKAEPMLREQIIMERSASLQCKDENQTAIGKLLNHF
Download sequence
Identical sequences G1KX09
XP_003221763.1.98722 XP_008110175.1.98722 XP_016849574.1.98722 XP_016849575.1.98722 XP_016849576.1.98722 ENSACAP00000019737 ENSACAP00000019737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]