SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000020058 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000020058
Domain Number 1 Region: 803-817,846-1223
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 4.71e-91
Family Formin homology 2 domain (FH2 domain) 0.0000667
Further Details:      
 
Domain Number 2 Region: 3-154
Classification Level Classification E-value
Superfamily ARM repeat 9.64e-20
Family Diap1 N-terninal region-like 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000020058   Gene: ENSACAG00000006717   Transcript: ENSACAT00000026823
Sequence length 1357
Comment pep:known_by_projection chromosome:AnoCar2.0:6:57752584:57893023:-1 gene:ENSACAG00000006717 transcript:ENSACAT00000026823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLYVDGMNGVINHSETIQWLYTLIGSKFRLVVKTALKLLLVFVEYTESNAQFLIHAVSTV
DGKRDLKPWSNIMEILEEKDGVDTELLVYTMTLVNKMLSGLPDQDAFYDVVDCLEELGME
AISQRHLNKKGADLDLVEQFNIYEMTLRHEDGDDNGEAPPSGRKDRRRTSLGCNEQRWLE
RRRSRRHSAQSAKSTLSAPASPCTQASPNFMSSYGQGTEDLSEKEEEYEEEEEQPVTEPN
TEDEGEEEATRQVKASELQELLAIKYSSQNSESSVTPSVLSQDERPPVSFRKQSPSRSPS
SSVPDSFASHHYTLPSSASSSVSINCIQNASSVTPKVSPMVEKMPYVPHSPFHLFSYDLE
EPSTVKEKETDGMREHRPSLGGLLTSSYRQHQESLAAERERRRQEREERLQRIEREERNK
FKYKYLEKLAAEEYEKELRSRSLCRGRNDLSLNLGSASPTTAASPQCASPASTDSQEELK
TPAIIFKTPQTPEVSASEPECEPEPEPEAENKTEQKDEAEFEQGTETPQEVEVAEVEPES
EVEQGPEQETEEGAILSEKERQNEDVNEKDNCSASSISSASSTLEREEREEKIISNSTAD
PWLQTIQDVSVNDQCSNILNNKRFMLDMLYAHNKKPRDETDKELEEKTEEKEMTEANEDT
LTSLASRISVLQATKQSKDESVKKMEVGNLDNQGSVKAFAERFNNSEMGKTTHFPESDFT
EKANEKIPVQTKKESDYIWDQLMANPRELKIKDMDFTDLRDEDDVDVLDMEMHPRNSLAA
PPPPPPSFFGLPPPPPPLFYGCPPPPPPSSNLLAPPPIFGIAQGLGSPPLPRGQPAFVKK
KKTIRLFWNEVRPFEWQCKNNKCCKGFLWSKLEPIKVDTSKLEHLFESKSKELPVTKKTA
ADGKRQEIIVLDSKRSNAINIGLTVLPPPRTIKTAILNFDEYALNKEGIEKILTMIPTEE
EKQKIQEAQLANPDIPLGTAEQFLLTLSSITELTPRLQLWAFKMDYELVEKEVAEPLSDL
KEGMDQLENNKTLAFILSTLLAIGNFLNGTNAKAFELSYLEKVPEVKDTVHKQSLLHHVC
TIVVEKFPDSTDLYSEIGAITRSAKVDFEQLRDNLCQIEKRCKASWDHLKAIAKHEMKST
LKQKMSEFLKDCAERIIILKIVHRRIINRFHSFLLFMGYPPYAIREVNINKFCKIISEFA
LEYRTTRERVLQQKQKRANHRERNKTRGKMITDTDEEDDNESGKFSSSSPTPQNQPQGLQ
YAEDAVEHENMKAVLKISSPAGENTSMLGVRTRSRANRGRIGSWNTGNDDSPNATDDTAD
EIMDRIVKSATQVPNQRAVPRERKRSRANRKSSFCES
Download sequence
Identical sequences G1KXG0
ENSACAP00000020058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]