SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000020331 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000020331
Domain Number 1 Region: 80-337
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 4.71e-110
Family Transcriptional factor tubby, C-terminal domain 0.0000000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000020331   Gene: ENSACAG00000017155   Transcript: ENSACAT00000024922
Sequence length 337
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343382.1:955054:984969:1 gene:ENSACAG00000017155 transcript:ENSACAT00000024922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEAEDDSDSSAKPTKSEKKKTTASMFQTGGEASKEKKTKKKAPTKAAENESEEEEAAQKN
TNKKGKAKKSKKKEERPPSPVIEVENLEEFVLQPAPQAVTIKCRVTRDKKGMDRGLYPTY
YLHLDNDKKVFLLAGRKRKKSKTSNYLISIDPTDLSRDGDNFIGKLRSNLMGTRFSVFDN
GVNPDRGNADWSNVRQELAAVIYETNVLGFKGPRKMTVVIPGMNSDSERVPIRPRNDNDG
LLMRWQSKIMDNLIELHNKAPVWNDETQSYVLNFHGRVTHASVKNFQIVHCNDPDYIVLQ
FGRVADDAFTLDYNYPLCAVQAFAIALSSFDGKLACE
Download sequence
Identical sequences H9GP08
ENSACAP00000020331 ENSACAP00000016886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]