SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000021238 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSACAP00000021238
Domain Number - Region: 53-126
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0115
Family Formin homology 2 domain (FH2 domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000021238   Gene: ENSACAG00000027388   Transcript: ENSACAT00000028171
Sequence length 143
Comment pep:novel contig::AAWZ02036854:12031:17968:-1 gene:ENSACAG00000027388 transcript:ENSACAT00000028171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVWQYSRASFATSSVSRLFPQLLHSNSNVKLSLPPPPPSPHPRDLPPLGCAAVSWEQYQQ
LQQQFLQAERTCHRLQEELESRPSETNTPQSGQEQLLKMMERRMMDVEQQLRLVKRLLQD
KVNQLKEQVSHPHRWEIQRSAQS
Download sequence
Identical sequences H9GVC4
ENSACAP00000021238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]