SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000021356 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000021356
Domain Number 1 Region: 619-990
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 1.44e-92
Family Formin homology 2 domain (FH2 domain) 0.00000499
Further Details:      
 
Domain Number 2 Region: 18-338
Classification Level Classification E-value
Superfamily ARM repeat 5.35e-77
Family Diap1 N-terninal region-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000021356   Gene: ENSACAG00000011137   Transcript: ENSACAT00000029038
Sequence length 1334
Comment pep:known_by_projection chromosome:AnoCar2.0:1:4239613:4287420:-1 gene:ENSACAG00000011137 transcript:ENSACAT00000029038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEKTVQPAKMSAKKEGAHKKWAALKEKLGSQDSDQTEANLENAEPELCIRLLQIPSVVN
YSGLKKRLESSDDGWMVQFLELCGLDLLLEALDRLSGRGVSRISDALLQLTCINCVRAVM
NSQKGIEYIVSNEGYVRKLSQALDTSNIMVKKQVFELLAALCIYSVDGHALALDALDHYK
TVKNQQYRFSVIMNELSATDNVPYMITLLSAINAVILGTEELRARTQLRNEFIGLQLLDI
LNRLRDIEDVDLLIQCETFEEAKSEDDEELLKICDGIDMSNHQDVFSSLFNKVSSCPASV
QLLSILQSLLHLEPSHHSSLLLWEALEILVNRAILLASDIQGNSVEEVMERLLSIKKPAK
KRNSESRRSVNRVNESTQTSEDLGEHFKAAKNSPAITCSSDIPPATDVSEKVAASQLPPC
SALPGQNSNPPSMLPLSSTPSPPPPLPPPPPPLPGAQIPPPPPPPLPGMKGMPPQAPPLP
SMAGIPPPPPPLPGMAVIPPPPPLPGLPPPPPPLPGAVVIPPPPPLPGMPPPPPPLPGMT
GIPPPPPLPGMPPPPPPLPGMAGVPPPPPLPGMAGIPPPPPLLGGNIEEVVVARVDYSLG
CARPIHRRVKPPTLRMKKLNWQKLPSNVAREGHSMWASATSSSEETIEPDYTSIEQLFCF
PQAKPKSKEAAAVKTEPKEITFLDSKKSLNLNIFLKQFKCSNEEVVDMIQKGDRTKFDVE
VLKQLLKLLPEKHEIENLKSFKEEKEKLSNADQFYLLLLGVPSYQLRIECMLMCEETAVV
LEMLQPKAETIRRACEDLLSSHRLPVFCQLILKVGNFLNYGSHTGDADGFKIGTLLKLTE
TKANQTRITLLHHILEEVEKNHIDLLQLPKDIEYVAKAAGINLDVIRSESSSNIKKLMEL
GRKLSSSTEEVKAQYEKAIQDSINANKKLEDEFENIEAKKVELANYLCEDPNKLSLEDIF
NTLKTFRDLFIKALKENKDRKEQVAKAEKRKKQLEEEEAKRQKGENGKIIKKGVVKQDDV
CVIDALLADIRKGFQLRKTARNKGDPDTPAKGSPSQPQKGKDTGSTVQAVKDTMNEEDGV
IVQNNLQGLLEKTVISGADAINAKQEDVVDLPASHTSSGDGGNGRHTPSHPDPDKSSLNS
FTLERIMEPNNGTNLQERTVSHSIQDMNDNDLELSQSSSFIKFGSTDSSSWKSGGGLVCS
GGSDFGFCSQNSLNSNDQVNKDIRKNSVVQDTSGEVQGLPTSDVPAATKESTKENNEPSI
DSLLDTTHEKSFSEEPLTDTTCSATVPSEQALVEKDSQKGSNKRRKKKRHSKSNPMVDTD
LKAVGDTKRGCEIQ
Download sequence
Identical sequences G1KZ26
ENSACAP00000021356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]