SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000021629 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSACAP00000021629
Domain Number - Region: 18-27,88-108
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00183
Family Formin homology 2 domain (FH2 domain) 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000021629   Gene: ENSACAG00000002015   Transcript: ENSACAT00000028204
Sequence length 181
Comment pep:known_by_projection chromosome:AnoCar2.0:1:246396747:246401707:-1 gene:ENSACAG00000002015 transcript:ENSACAT00000028204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKRLAEFRAARQASAAPPAPPPPPPPAKTPRAEATAGKEQASPPPEVGCLRRRGEARCQ
GDRARKRPPMRKSESSQSPKAQAATTPLPWWTHSFFMNVTFLKFLLWLVLLGLFAELEFG
LAYFVLSMFYWIYVGTRGPGERQTGEKSAYSVFNPGCEAIEGTLTAEQIERELQYQPLLW
R
Download sequence
Identical sequences G1KZD6
ENSACAP00000021629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]