SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000021700 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000021700
Domain Number 1 Region: 53-417
Classification Level Classification E-value
Superfamily ARM repeat 1.68e-99
Family Diap1 N-terninal region-like 0.0000404
Further Details:      
 
Domain Number 2 Region: 616-995
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 2.49e-95
Family Formin homology 2 domain (FH2 domain) 0.00000243
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000021700
Domain Number - Region: 395-514
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0314
Family HBL-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000021700   Gene: ENSACAG00000029141   Transcript: ENSACAT00000029120
Sequence length 1070
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343261.1:1616999:1732619:-1 gene:ENSACAG00000029141 transcript:ENSACAT00000029120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRKRSGRGISFIFCCFRSNDHPEITYRLRNDSNFALQTMEPAFPMPPVEELDVMFSEL
VDELDLTDKHREAMFALPAEKKWQIYCSKKKDQEENKGATSWPEFYIDQLNSMAARKSLI
ALEKEDEDERNKTIESLKTALRTKPMRFVTRFIDLDGLTCILNFLKSMDYETSESRIHTS
LIGCIKALMNNSLGRAHVLAHSESINVIAQSLSTENIKTKVAVLEIMGAVCLVPGGHKKV
LEAMVHYQKYASERTRFQTLINDLDRSTGRYRDEVSLKTAIMSFINAVLSQGAGVESLDF
RLHLRYEFLMLGIQPVIDKLREHENSTLDRHLDFFEILRNEDELEFAKRFELVHIDTKSA
TQMFELTRKRLTHTEAYPHFMSILHHCLQMPYKRNGNTVQYWLLLDRIIQQIVIQNDKGQ
DPDSTPLENFNIKNVVRMLVNENEVKQWKEQAEKMRKEHHELQQRLEKKERECDAKAQEK
EEMMQTLNKMKEKLEKELSEHKQAKQQVVDLTAQIHELSRRAICAPVPGGPPLPPGAPGG
PLPTAALGSLLPVPPPPPPPGGFLPPPPPPPPPPGGPPPPPGPPPLGGLPPAPGAPLGLG
LKKKNIPQPTNALKSFNWCKLPENKLEGTVWTGIDDGRVFKVLDLEDLERTFSAYQRQQK
EDTLDDTLSARHKVKELSVIDGRRAQNCNILLSRLKLSNDEIKRAILTMDEQEDLPKDML
EQLLKFVPEKADIDLLEEHKHELDRMAKADRFLFEMSRINHYQQRLQSLYFKKKFAERVA
EVKPKVEAIRTASTEVFQSKSLKQLLEVVLAFGNYMNKGQRGNAYGFKISSLNKIADTKS
SIDKNITLLHYLITIVEKKYPNVLNLHEELKDIPGAAKVNMTELEKEIGTLRSGLRAVET
ELEYQKTQPSHPGDKFVSVVSQFITVASFSFSDVEDLLSEAKELLTKSVKHFGEEPSKMQ
PDEFFGIFDQFLQAVNEAKQENENMRKRKEEEERRARMEAQLKEQRERERKARKAKENSE
EGGEFDDLVSALRSGEVFDKDLSKLKRNRKRITNPLADGSRERPVTKLNF
Download sequence
Identical sequences R4G922
XP_008114941.1.98722 ENSACAP00000021700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]