SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000021999 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000021999
Domain Number 1 Region: 120-298
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 0.0000392
Family At5g01750-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000021999   Gene: ENSACAG00000006857   Transcript: ENSACAT00000029417
Sequence length 308
Comment pep:novel scaffold:AnoCar2.0:GL343435.1:310107:362033:-1 gene:ENSACAG00000006857 transcript:ENSACAT00000029417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSKNAAPGYPGPPTQYGYPQYAPGPGQYPPGPGQYPPGPGQYPPGQGQGFAGQPPYQPM
GYQGAYGAPPVQGQPNGVMWMPAPPPPANCPPGLEYLSQIDQILIHQQIELLEILTGFET
CNKYEIKNSLGQRVYFAAEESDCCTRNCCGSSRPFTMKIMDNMGQEVIELLRPLKCSSCC
FPCCLQELEVQAPLGTVIGYIKQNWHPCLPRFAIQNEASENVLKIAGPCAPCTCFQDIDF
EVSTQDEKPIGRISKQWTGYIREMATTASNFEILFPFDLDVKMKALILGASILLDYMYFE
HKRRRSDR
Download sequence
Identical sequences R4G9T2
ENSACAP00000021999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]