SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000022538 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000022538
Domain Number 1 Region: 6-147
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-39
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000237
Further Details:      
 
Domain Number 2 Region: 677-715
Classification Level Classification E-value
Superfamily Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.000000000000353
Family Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.0013
Further Details:      
 
Domain Number 3 Region: 488-498
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000392
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000022538   Gene: ENSACAG00000013325   Transcript: ENSACAT00000029955
Sequence length 717
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343270.1:1061955:1216228:-1 gene:ENSACAG00000013325 transcript:ENSACAT00000029955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYAFEEFSEQSICQARASVMVYDDTSKKWVPIKPGQQGFSRINIYHNTASNTFRVVGVKL
QDQQVVINYSIVKGLKYNQATPTFHQWRDARQVYGLNFASKEEATTFSNAMLFALNIMNS
QQDGGPTTQRQVQNGPSPDEMEIQRRQAMEQQQQQRQESLERRTSTTVSTLQIKVSSSPF
HCQSPPPDYSHYNASPSTGAVPPPPPYAKVISSASPPLPEPTSRASFRSAVPGGRESALH
CHRPSASEFLPPPGPSFPPAWPSHRTVTQSTKQIPPSPPPAPASHYPFNSHQPLRRSSLS
YSPHSSSSPPVTLAHPIPKGLILQPHIPVVLPVISASNGRVRGPTDSVVQDVSAHVPHLG
LNGHREEHLTTQVPLNSSMTQVKRTDGSFFSYLEAVPVSHLPIVSSPAGTFIQGFSQPSQ
QLPYSPHQFYPSMPHFVALPPHYAAVSEVNFSKRTPPYMTSSTISHLSPVLPPGHPSAAG
LPTLSGGPPPPPPPPPPPTGTAPPPPPPLPIGGGGTNIDDGSVSGLAAALAGAKLRRVQR
PEDGSGGSSPCGASKSDANRTSSGGGGLMEEMNKLLAKRRKAASQSDKPADKKEEESQNE
DASTSPSPVSRGPVQQQNSSDAGKKLWERSNSVEKPVASLLSRNPSVDTCSEPKSPIQYQ
PSSRMKPASSSNDVAMDTLDFDRMKQEILEEVVKELHKVKEEIIDAIRQELSRISTT
Download sequence
Identical sequences R4GB69
ENSACAP00000022538 XP_008115143.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]