SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000022869 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000022869
Domain Number 1 Region: 347-514
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-42
Family SPRY domain 0.00011
Further Details:      
 
Domain Number 2 Region: 10-82
Classification Level Classification E-value
Superfamily RING/U-box 4.57e-22
Family RING finger domain, C3HC4 0.025
Further Details:      
 
Domain Number 3 Region: 98-154
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000443
Family B-box zinc-binding domain 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000022869
Domain Number - Region: 212-323
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0706
Family Formin homology 2 domain (FH2 domain) 0.013
Further Details:      
 
Domain Number - Region: 135-247
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0816
Family FCH domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000022869   Gene: ENSACAG00000028629   Transcript: ENSACAT00000030287
Sequence length 519
Comment pep:novel chromosome:AnoCar2.0:2:194957542:194970893:1 gene:ENSACAG00000028629 transcript:ENSACAT00000030287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGVSGGSVQDLCEEATCSVCLDYFRDPVTLAECGHNFCRACLGRWWGDSEKEAFCPQCR
LTLQSRDVIPNRPLANFVEITKKLSLQGPRGAGAMGGVCGEHQEPFKFFCKEHQRPICVV
CDRAKEHREHTVIPLQEAAQEYQDQICNCLKNLKEDKEKFLASKAAIEKESQDLLNETEV
EREKVMSAFRELHHFLEDQEKRLLVQMEEIEKEIIRKRKEHLARFSREISFLGSLIQEME
EKLHQEASESLQDIGRILKKTEKRGTFCSVVFIPSAMKLKISNMRNMNPFLEGALKKFED
LFLERKKMEEVAGNMAEFRSESTGIRAQPQFPRRWEDVLLSGPPPKKVNVTLDRDTAFPR
LVLSEDLKCVRWDQKYQNLPENPGRFNLSSFVLGREEFSAGRYFWDVSVGSEERWAVGVA
RKSVRRKGPVLISPGSGICAVEKSEGEYKACIPPDNPLLNLNEKLRKIRVFLSCAENQVA
FYNADTGDFLFGFVGMCFGGQPILPFFRVFLEGHLRISS
Download sequence
Identical sequences R4GC13
XP_008103926.1.98722 ENSACAP00000022869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]