SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000023037 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSACAP00000023037
Domain Number - Region: 111-123
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00889
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000023037   Gene: ENSACAG00000003704   Transcript: ENSACAT00000030457
Sequence length 720
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343941.1:92992:112091:1 gene:ENSACAG00000003704 transcript:ENSACAT00000030457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIHELLLALRGYAGGLFVAGGGLQVRSHAPASFPLSLAPKRPAPEARLLFLFSSPGRCLP
RRRRCCSTRARPALLGRLLRLGALYLRFSDFAEPANHNHASEAPPPPSQAPPPAPPPTPP
LPPPQELPPPGIYLRAFCAGLDAVLQPYRQALLDLEQEFLADPHLTVAHINYSLDQFQLL
FPSLMVVVEQIKAQKIHGCQILEVVHRHSRGGLPPVRQALERILATCHAAMYKQLSAWML
HGLLMDQYEEFFIRQGPSSSSGSGPTQLDEDEDDLGIGGLTGKQLRELQDMRLIEEENML
APSPKQFSLRVEMLPSYIPAHVAEKILFVGETVQMFESQNISLTKKGSILKDQEDTFAAE
LHRLKQRPLFNLADFESVVDWIRSAVAEHLWKLLVEESDLIGQLKIIKDFYLLGRGELFQ
AFIDTAQQMLKTPPTAVTEHDVNVAFQQSAHKVLLDDDNLLPLLHLTIHYHGKEHRDASQ
AREVLPSRELSPHESPTSGWAALGLSYRVQWPLHILFTPAVLEKYNVVFKYLLSVRRVQA
ELQHCWALQMRSKRLESSRTDAIKWRLRHHMTFLVDNLQYYLQVDVLESQFSQLLQQINA
TRDFESIRRAHDHFLSNLLAQSFILLKPAFHCLNEILDLCHNFCSLVSQNRGPLDERGAA
QLSILAKGFSCQSSLLFKLLSSVHNHQINSDLAQLLLRLDYNKYYTQAGGTLGSVGLLDQ
Download sequence
Identical sequences R4GCH3
XP_016854137.1.98722 ENSACAP00000023037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]