SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000001884 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000001884
Domain Number 1 Region: 7-98
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.51e-24
Family Ubiquitin-related 0.0000349
Further Details:      
 
Domain Number 2 Region: 532-583
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000973
Family UBA domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000001884   Gene: ENSACAG00000001880   Transcript: ENSACAT00000001930
Sequence length 587
Comment pep:known chromosome:AnoCar2.0:2:42676593:42701741:1 gene:ENSACAG00000001880 transcript:ENSACAT00000001930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEGGESPPGPQGPAESPAASAAEPRIIKVTVKTPKEKEEFAVPETSSIRQFKEEISKRF
KAHTDQLVLIFAGKILKDQDTLTQHGIHDGLTVHLVIKTQNRSHDNSAQQSSTAGSTATT
TTSTSTTSTNSTNTSPFGLGGLGGLASLSSLGLNTSNFSELQSQMQRQLMSNPEMMVQIM
ENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEISHMLNNPDIMRQTLELARNPAMMQE
MMRNQDRALSNLESIPGGYNALRRMYTDIQEPMLNAAQEQFGGNPFASLVSNSTSGGDSQ
PSRTENRDPLPNPWAPQSGTQSSPSSGSTSGDNGGGGSNAGSSTTTSTGQSATAPNLGPG
LGSGMFSTPGMQSLMQQITENPQLMQNMLSAPYMRSMMQSLSQNPDLAAQMMLNNPLFAG
NPQLQEQMRQQIPTFIQQMQNPDTLSAMSNPRAMQALLQIQQGLQTLATEAPGLIPGFNA
GLAGSAGLGSTSIPTGTTAPTSVPSENATPASGTGETGQQQFVQQMLQALAGANAQQLQN
PEVRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLGSQPS
Download sequence
Identical sequences G1KA21
ENSACAP00000001884 ENSACAP00000001884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]