SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000002009 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000002009
Domain Number 1 Region: 215-307
Classification Level Classification E-value
Superfamily TAFH domain-like 2.62e-33
Family TAFH domain-like 0.0000314
Further Details:      
 
Domain Number 2 Region: 638-686
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000000701
Family TBP-associated factors, TAFs 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000002009   Gene: ENSACAG00000002056   Transcript: ENSACAT00000002057
Sequence length 843
Comment pep:known_by_projection chromosome:AnoCar2.0:4:36730138:36808152:-1 gene:ENSACAG00000002056 transcript:ENSACAT00000002057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAPPPPGTGKVMLPGPPDRLQSGQVAPKTLLVTPLAVQSPSDARVPLGQIPPRVVPSSE
ETLAPKVASQATSALQLPANFQIAPGTVLVRSNTGQLILVSQQALVQAQSQTQSNASVRW
TVPTLSSTVKLQNPQNSVSQVLKVLPAPVKTVPRTTHPIKKSVIQSVSSTKSNSTNMMIK
GPLANPPAFDFHIQPVAPKPVPDADSTTVAQASTSAEMLENAQKCKNFLATLIKLASSGA
QAPEMGQNVKNLVENLLEAKIEPEEFTKKLYIELKSSPQPCLVPFLKKSVRALRQLIPDP
QTFIQQCLQQSVPRTAASTCATALSSVSAVANSTPLTFQSARTVLRTSVGISSPQTSVPV
PCTSLVTRGSASLQLVQPDHALPLGTLSLQGANSVPPTQLAADITTVKPTSSVAVVKTSN
TLLPIIKPMPTPVAVSSAACAALNSGKAVSPSAVATSLQVGKPALTSSALTTSSKAVATT
LPVTGKPIAIRVAYPNSVISQPARTSQPVTVKQLIVQQASGNAVKKVSTLQQASALSSVN
KASGKMPLNTVIHTNQLPSGCIVKQITLPGNKILSLQASPVQRNKIRANGTTSFRDEDDI
NDVTSMAGVNLSEESACILTSHSEAVGSVIQSCPEELLLSSDVLQKKIIEIGKKHGITEV
NSDVLNLISHATQKRLRGLLEKLTVIAQHRMVTYKENDNYTVSNDTRAQLTFLEQLDQVE
KQRKDEEERERLLRAAKSRSNKEDPEQLRLKQKAKEMQQLEFAQMQQREANLAALAAIGP
RKKRTLDSSSLASGLEGVNRLSNRVKLPLHPRMTRICLRDLIFCMEQEKGMKRSLALYRG
LLK
Download sequence
Identical sequences G1KA85
ENSACAP00000002009 XP_008106828.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]