SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000002675 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000002675
Domain Number 1 Region: 86-178
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.13e-19
Family Ubiquitin-related 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000002675   Gene: ENSACAG00000002776   Transcript: ENSACAT00000002742
Sequence length 186
Comment pep:known_by_projection chromosome:AnoCar2.0:3:39258014:39263800:-1 gene:ENSACAG00000002776 transcript:ENSACAT00000002742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAYAVESNDHGLAQAIIDGAGVTLPHGS
LTECYDELGNRYQLPVYCLAPPVNLIMERSEEEGVEPPEPAPNTRREFPLKVRLSTGKDL
RLSASMTDTIGQLKKQLYAQEELEPGWQRWFFSGKLLTDRTRLQETKIQKDFVIQVIINQ
PPAPRN
Download sequence
Identical sequences G1KB52
ENSACAP00000002675 XP_003218516.3.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]