SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000002850 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000002850
Domain Number 1 Region: 125-305
Classification Level Classification E-value
Superfamily HAD-like 3.4e-30
Family NLI interacting factor-like phosphatase 0.047
Further Details:      
 
Domain Number 2 Region: 3-80
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.18e-19
Family Ubiquitin-related 0.0000287
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000002850   Gene: ENSACAG00000002895   Transcript: ENSACAT00000002921
Sequence length 318
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343205.1:4217432:4239734:1 gene:ENSACAG00000002895 transcript:ENSACAT00000002921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSLIIKWGGQEFSITTLSEEDTVLDLKQSLKGLTGVLPERQKLLGLKVKGKPAENDVK
LGTLKLKPNTKIMMMGTREESLEDVLGPPPDNEDVVNDFDIEEEVVEVENREENLLKISR
RVKEYKVEILNPPREGKKLLVLDVDYTLFDHRSCAETGVELMRPYLHEFLTSAYEDYDIV
IWSATNMKWIEAKMKELGVSTNSNYKITFMLDSAAMITVHTPRRGLIDVKPLGVIWGKFS
EFYSKKNTIMFDDIGRNFLMNPQNGLKIKPFMKAHLNRDKDKELLKLTQYLKEIAKLDDF
LDLNHKHWERYLSKKQGQ
Download sequence
Identical sequences H9G6V9
ENSACAP00000002850 ENSACAP00000002850 28377.ENSACAP00000002850 XP_003223511.1.98722 XP_008113011.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]