SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000004399 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000004399
Domain Number 1 Region: 321-420
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.4e-31
Family Ras-binding domain, RBD 0.0041
Further Details:      
 
Domain Number 2 Region: 456-568
Classification Level Classification E-value
Superfamily PH domain-like 6.58e-16
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000004399   Gene: ENSACAG00000004500   Transcript: ENSACAT00000004500
Sequence length 1254
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343208.1:3010015:3092689:1 gene:ENSACAG00000004500 transcript:ENSACAT00000004500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQLSDEELDHGAEEDSDKEDQDLDKMFGAWLGELDKLTQSLDTDKPMEPVKRSPLRQET
NIANFSYRFSMYNLNEALNQGEAVDLDALMADLCSIEQELSSIGSQSANSMSMKRFAADG
KMAQKPPGSVRVAAKHSSMKGLSSSSSSRATKPSHAIFSLDDITAQLEKASLSMDEAAQQ
PVMEDSKPIVATQHRRTASAGTVSDAEVRSISTSSRSSITSAASSMDSLDIDKVTRPQEL
DLTQQGQPVSEHIVSMEHSSKQARRHIDFSEEEAELAPHSYLDRETSLLLRNIAGKPSHL
LTKEEQAAKLKAEKIRVALEKIKEAQVKKLVIRVHMSDDSSKTMMVDERQTVRQVLDNLM
DKSHCGFSLDWSLVETISELQMERIFEDHENLVENLLNWTRDSQNKLMFVERIEKYALFK
NPQNYLLGKRETSEMADRNKEVLLEECFCGSSVTVPEIEGVLWLKDDGKKSWKKRYFLLR
ASGIYYVPKGKAKVSRDLVCFLQLDHVNVYYGQDYRNKYKAPTDYCLVLKHPQIQKKSQY
IKYLCCDDIRTLHQWVNGIRIAKYGKQLYVNYQEALKRTESAYDWTSLSSSSIKSGSSSS
SLPESQSNHSNQSDSGLSDTQTGHVRSQSIVSSIFSEAWKRGTQLEESSKISARMDSMNR
PFPSFAPPLSPQTKTAAPFTASQPSPPLPPPPPPPPPPPPPPPPPPPPLPSQSLSSGAGS
ATVFVKYSTITRLQNAAQHGGLLFKPPLMMHQATPLPPPGKPQNLLPPNGVIPPPPPPPP
PPTPGSAMAQLMKPVPSAPSVPQFTPPPPPAPPLKIHQVHQSIPQPTASPPPPPAIPAPP
PPQAPPKPAMTLPTQNSTKAASPVVAHPTPPAPLPSAVKKQPSFTMPPAPLSPVPLGPTP
PPTLPKQQNYSSKLPPSPQSPVPSVVKQIASQFPPPPLPVSEPQPLKPAPLSVPPPSPPA
VKAKPKWQPTSAPSPDFPPPPPESSLAFPPPPSPSPLVVSPTPDKTGGSPVKKAGKSSSP
GGKKPPPTPQRNSSIKSNSSAEYHESKRPSVDSLVSKFAHPPEPSGSPSKESPNPPAAPP
KPGKLTLPIALQQAGISAKTPGKGAVEEFPSPPSDSDFPPPPPEIDLPLPPVEIPAVFSG
NTSPKVAVVNPQPQPWSKSSMKKAPPPTRPKRNDSTRLTQAEMAEAQVTTASPQVPTSPK
SSLSVQPGFLADLNRTLQRSPSPATAPSPPPGYPEQSQWQPWMTWLCLHPHLNF
Download sequence
Identical sequences H9G959
ENSACAP00000004399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]