SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000005496 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000005496
Domain Number 1 Region: 246-406
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 2.43e-45
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00034
Further Details:      
 
Domain Number 2 Region: 12-54
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000222
Family Ovomucoid domain III-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000005496   Gene: ENSACAG00000005622   Transcript: ENSACAT00000005616
Sequence length 662
Comment pep:novel scaffold:AnoCar2.0:GL343194.1:9814233:9825915:-1 gene:ENSACAG00000005622 transcript:ENSACAT00000005616 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RNIALPPQGQGAACTREKAPVCGSDGITYNNKCLFCVAKRDSGNTITIVHEGPCEQKGGS
KTTKKPSKQITDFSTSSSTSSSSSSEPSTKQKPDRKRDSSSSSDSSDSSDSSSDSSSSES
SQISKKDKSATVYYNVSNQSGSVYSNLPTSITGELSHPKAEIPLTVSNTPADYINMFKKQ
SRKIVKSTIQNVGGRKAIYWFSFRSVKQQGTKQETDGKQRPSPASSSSSSEEDVKSQGKW
IRISDIRVRILCRDNKPRGFDVVVFKTPNWLRMTVTNITQPSKPFICWDSGMVNPYKVKS
SLKAGRDCKEYEVTTEVETGSLAGHPALRWKLEYPRIPSSLSTILEPYYERTPGVAYMLG
LSHVIQRNSAREVSVVLALITRLNYAMVMRIPGNTLYKEDLMLPVAVPLSPYLQTSKIID
VPSRILASLDGMCEVKGQTVTTFHGQSISKGLPSNCYLDLLQDCTCHKDFMVLLKYESHN
NNSILLNTTINYTEFIFKYQDSKPLVIINGTVIKPDEPVLRNLRDTNGMILTVRPDEISL
QSEKVGLKNLVYKGHYVKVEVTPAIGLTCGLCEMQGGEEGHLRTPSGYMAKDLVSFAQSW
VVPDALDGTCKLQHSTVTHENPVLVAEENSQCVSNHPVLQCQEGCLPTETMFFSFPRDDF
AN
Download sequence
Identical sequences H9GAE5
ENSACAP00000005496 ENSACAP00000005496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]