SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000007218 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000007218
Domain Number 1 Region: 535-651
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.18e-30
Family UBX domain 0.0000318
Further Details:      
 
Domain Number 2 Region: 336-491
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000514
Family Glutathione peroxidase-like 0.078
Further Details:      
 
Domain Number 3 Region: 190-260
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000799
Family Ubiquitin-related 0.042
Further Details:      
 
Domain Number 4 Region: 92-179
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000152
Family Ubiquitin-related 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000007218   Gene: ENSACAG00000007308   Transcript: ENSACAT00000007373
Sequence length 653
Comment pep:known_by_projection chromosome:AnoCar2.0:4:113537776:113786554:-1 gene:ENSACAG00000007308 transcript:ENSACAT00000007373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCVCVQEERGVLRPPTQACTGIENIDEAITLLEQNNWDLVAAINGVIPQENGILQSEYSG
ETLQGPAYDPSSHPSSSSSTPSSSSAFRHVVPSRQIVERQPRMLDFRVEYRDRNVDVVLE
DSSTVGEIKHILENELQISASKMLLKGWKSGDVDDGTVLKTLHLPKNNSLYVLTPDLPPP
SSSSMPGTLQESLNQNFMLIVTHREVQREYNLNFSGSSSIQEVKRNVYDLTSIPVRHQLW
EGWPASATDDSMTLAASGISYPCHRLTVGRRSSPAQTREQSEQQCTDVHMVSDSDGDDFE
DATEFGVDDGEMFGMASSALRKSPMMPENAENEGDALLQFTAEFSSRYGDCHPVFFIGSL
EAAFQEAFYGKARDRKLLAVYLHHDESVLTNVFCSQMLCAESIVSYLSQNFITWAWDMTK
EANRARFLTMCTRHFGSVVAQTIRTQKTDQFPLFLIIMGKRSSNEVLNVIQGNTTVDELM
MRLMAAMEIFSAQQQEDIKDEDEREARENVKREQDEAYRISLEADRAKREAQEREIAEQF
RLEQIKKEQEEEREAIRLSLEQSLPPEPKEENTESVSKLRIRTPSGEFFERRFLANSKLQ
VVFDFVASKGYPWEEFKLLGTFPRRDVTHLDPNKSLLELKLYPQETLFLEAKE
Download sequence
Identical sequences G1KGH5
ENSACAP00000007218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]