SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000007396 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000007396
Domain Number 1 Region: 127-276
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000113
Family Ankyrin repeat 0.0018
Further Details:      
 
Domain Number 2 Region: 78-129
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000875
Family Ubiquitin-related 0.013
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000007396
Domain Number - Region: 18-55
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000221
Family Ubiquitin-related 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000007396   Gene: ENSACAG00000007568   Transcript: ENSACAT00000007553
Sequence length 499
Comment pep:known_by_projection chromosome:AnoCar2.0:3:18793511:18817078:1 gene:ENSACAG00000007568 transcript:ENSACAT00000007553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIKDYFHVPLSEDKQGRRYLKLMYAGAVLKDSWILADVGISVSSMIKCVLKEENKPILYV
CNAVTHEKVPIMGRMYLLSSKVSQLKNLVTLKTGFPSSIYCLRTQEGREMYDCNTLSDYQ
LDIGATLHLDVWDGWKEFLTGCVLGNTPKVRRYLSKEEPVLKYQRRVALYMAAFFGHLQL
SAWLLKKSTKPTEPIGVHPYREWCHENSHPDITKCPVHAAAEAGQLVMLKAFVNFSALCL
ECQNSAGQTPLQLCIQHRHKDCVLYLVTKIWSVVSCPNFSLPMKIYIKLKLWLLQAQKNI
HRKKRRIQTATFRTRVGDVVLVDGFTKSKMTSRSLYSSRVKDVDGRGCKLPSLNDQFQHE
EGSHSRISKRHFKGTNVKLPPVIDGNKRADMHKRQQKKSNKRKKRPLSSADYMDQHMCLA
RVPLPPGPVHKPSYYYSIPNAKFLLKPSLASFSEHSGRTPRENAIYCLAIASSFKEKPWL
QQLNIARTLAKKSICKAMY
Download sequence
Identical sequences G1KGR4
XP_016847552.1.98722 ENSACAP00000007396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]