SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000010060 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000010060
Domain Number 1 Region: 12-85
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.02e-28
Family UBX domain 0.0000586
Further Details:      
 
Domain Number 2 Region: 364-452
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000465
Family UBX domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000010060   Gene: ENSACAG00000010247   Transcript: ENSACAT00000010267
Sequence length 453
Comment pep:known_by_projection chromosome:AnoCar2.0:2:118261684:118357322:-1 gene:ENSACAG00000010247 transcript:ENSACAT00000010267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAVGGGGSSGAVSVLAPNGRRVTVRVGPSTALLQILEEVCRKQNFSPNEYDLKFQRTVL
DLSLQWRFANLPNNAKLEMVPISRNRAGTETAVRIALQLDDGSRLQDTFSSTHTLWDILH
HFSQTREYVEEHCEVSPICIYMRDEVTGKTALEKTSLKSLGLTGGNAIIRVVTKKTSTSP
SQTETENSEYLSKGSTGSTSSGEEQAGSPVPHSPVFSTSSVCSHDPALDKKCTDKQDLNK
ESQKSSEEHQPASEPVPSSFVPFVGDGQRLGGGSPVEMISPMSDVPMSNLAQSLSSPGGP
SKPKKSKNSQGKPKEEKECLEREPIVCHPDLQHPLGSASQDLPDEFFEVTVDDVRKRLAQ
LQNERKRLEETPLMTQAQREAQIKEKLERYPKVVLRVYFPDRHILQGFFHPCETVGALRA
FVKSHLADPEIPFYLFITPPRSILTEDSLTLFQ
Download sequence
Identical sequences G1KJW8
ENSACAP00000010060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]