SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000010499 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000010499
Domain Number 1 Region: 431-554
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.14e-35
Family DEP domain 0.0000198
Further Details:      
 
Domain Number 2 Region: 12-89
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.1e-24
Family DIX domain 0.0014
Further Details:      
 
Domain Number 3 Region: 236-346
Classification Level Classification E-value
Superfamily PDZ domain-like 1.46e-23
Family PDZ domain 0.0000314
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000010499   Gene: ENSACAG00000010552   Transcript: ENSACAT00000010716
Sequence length 715
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343245.1:1590000:1638462:-1 gene:ENSACAG00000010552 transcript:ENSACAT00000010716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPAAGASAAETKIIYHLDEQETPYLVKVPIPAERVTLGDFKALLNRPSYKFYFKSMDD
DFGVVKEEISDDNARLPCFNGRVVSWLVSAEGSHSDAGSVCADNQPELPPSIERTGGIGD
SRPPSFHPNTGGSRENLDNETETDSVVSIQRERPRRKDGPEHVPRVNGTAKGERRRELGG
YESSSTLMSSELETTSFFDSDEDDSTSRLSSSTEQSSASRLMRRHKRRRRKQKVPRIERS
SSFSSITDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGR
IEPGDMLLQVNDINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRGCFSLPRIAP
QRIWAGPDSPCSDPGEPIRPIDPAAWVSHTAAMTGTYPAYGMSPSMSTITSTSSSITSSI
PETERLDDFHLSIHSDMATIVKAMASPESGLEVRDRMWLKITIPNAFIGSDVVDWLYHHV
EGFTDRRESRKYASNLLKAGYIRHTVNKITFSEQCYYIFGDLCGNMASLSLHDHDGSSGA
SDQDTLAPLPHPGAAPWPMAFPYQYPPPHPYNPHPGFPDPGYSYGGGSAGSQHSEGSRSS
GSNRSGSERRKEREPKAGESKSGGSGSESDHTSRSSMRRERAASERSLPASQRSHQLDGP
QLRSHHSQAVLRAPRPPAALQPSHAPDASRQPSALDPRGPPWPRPALRAPETDGK
Download sequence
Identical sequences H9GGP2
ENSACAP00000010499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]