SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000011640 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000011640
Domain Number 1 Region: 142-693,865-1058
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.2e-258
Family Motor proteins 0.00000000227
Further Details:      
 
Domain Number 2 Region: 2148-2335
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.81e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.0000978
Further Details:      
 
Domain Number 3 Region: 2083-2141
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000688
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0059
Further Details:      
 
Domain Number 4 Region: 17-112
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000723
Family Ras-binding domain, RBD 0.011
Further Details:      
 
Domain Number 5 Region: 1071-1113
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000046
Family Motor proteins 0.017
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000011640
Domain Number - Region: 1109-1160
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000717
Family Motor proteins 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000011640   Gene: ENSACAG00000011552   Transcript: ENSACAT00000011880
Sequence length 2646
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343479.1:402664:480750:1 gene:ENSACAG00000011552 transcript:ENSACAT00000011880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGNDVGGRRRFEDSEHTLHIYPGSIAEGTIYCPAIARKTSTAAEVIDSLINKLQLDKTK
CYVLAEVKEFGGEEWILNPTDSPVQRMMLWPRMALENRLSGEDYRFLLREKNLDGSIHYA
SLQSWLRVTEERRRMMERGFLPQPQYKDYDDLCALPDLNERTLLENLRNRFKQEKIYTYV
GSILIVINPFKFLPIYNPKYVKMYDNHQLGKLEPHIYAVADVAYHAMLLRRKNQCIVISG
ESGSGKTQSTNFLIHHLTALSQKGFASGVEQIILGAGPVLEAFGNAKTAHNNNSSRFGKF
IQVNYQETGTVRGAYVEKYLLEKSRLVYQEHNERNYHVFYYLLAGASEEEKSAFHLKQPD
EYHYLNQMTKRPPKQSWDDCYYESEPDCFTVEGEDLKHDFERLQLAMEMVGFFPKTRRQI
FSLLSAILHLGNICYKKKTYRDDSIDICNPEVLPIVSELLEVKEEMLFEALVTRKTVTVG
EKLVLPYKLAEAVTVRNSMAKSLYSALFDWIVFRINHALLNTKDLEESTKTLSIGVLDIF
GFEDYESNSFEQFCINFANERLQHYFNQHIFKLEQEEYRLEGISWHNIDYIDNTGCINLI
SKKPTGLLHLLDEESNFPQATNQTLLDKFKRQHEGNLYIEFPTVMEPAFIIKHYAGKVKY
GVKDFREKNTDHMRPDIVALLRSSKSAFICGMIGIDPVAVFRWAVLRAFFRAAVAFREAG
KRYTEKKPGHDDAVLKSVDSFSFLHHPVHQRSLEILQRCKEEKYSIARKHPRTPLSDLQG
VNTINEKAQRDAYGVGWNSRMCVRQSRLSNHSGFLDKDGIFVNSTNSKLLERAHGILMRN
KNFKAKPNLPKHLLEVKSLKHLANLTLHDRITKSLLHLHKKKKPPSISAQFQTSLTKLME
TLGQSEPYFVKCIRSNAEKLPLRFSDNLVLRQLRYTGMLETVRIRQSGYSCKYSFEDFVD
HFYVLLPQGTVPSKQNIQDFFRKTKVDPDNYQVGQTMVFLKEQGRQFLQGLLHEEVLRRI
TLLQSWFRAMLHRRHFLNLRQAATVIQKYWRHYLLRKKAESEEALDNSAHLDKAAVVLQA
HWRGWVARRRFQQMRMAGFTIQSYWRKCLRRRHAAATTIQAKWRTYHTRRLYRDTRNKVI
LLQAAYKGCRERERLRTLKKQSLRGSKLKNGVAVKEDGQEQEDGLDIKGSDPSDWEDGSF
EKRVKDVEEHKSGMENRVGHIDPLDNSRTSLYKHHERANSQSGTNLEEQVVVRERPKSLE
DLNQKKVVRAKRESRRMRELEQANFSLELLKVRSTGGTSPSEERQFSPEWISEEGHSPQG
TPESEISQGSLEMLSHEEIQKEKRDPMLLQEQNTQPFPQNSLLNSPQRDEIQGIPLFAAD
VNSNVPDRKQSVSSSEVPKCLATTERPVRDQQGIVHNVHTREPLISNSLPTFYLPPKDNL
QSGHSMIQNNLRNKQMEVRDTPFLPEVKKNSQLESPEHSYHGECQPSFTREEGSALKASE
VPSSDSILKKLEKLNVEKEERRKQKQLQNEKEMMEQIRQQKEILGKQRKVFEEFERQENE
QNRIREFSQGASLKSPKKIDEPQSVLIVNPQNKGEYCHSTGPETTASSNSTAFTAIKKES
PPASKMTQKERTIVMILERKEDRIPDAKEQSTSTEQLNSQAAANSQEGMSNPSARERRFR
LPRIPSQGTENLSSETRPGSIFFTPKECYMGTSQESSAHLLASKEEHKKPLKISGPFRGE
VARPAHKKKARMARTRSNFLTRGACADWEGDTEEEDCDDSFEFLLSLDQPPHPEPGCAAR
LGQPCHSDSEMMLQRFTSSEGQAKLHKTMSQGEIGKLASSQKIVAADGSRPQKAKMKFWG
KGKQGEKKMSREKLATQSELLEFYSSQDSTGLQLDEELTPPRSPELSGIYRRECKENKEP
SPKVKRKRSLKISSVTMEPAQWQNDALQIITSARDLKSMDEFLLKKMNDLDSEDCKKDTM
VDVVFKKALKEFRQNIFSFYSSALTMGDGNSIRYKDLYALFEQILEKTMKFEQRDWNESP
VRVWVNTFKVFLDEYMTEYMPLDYTAPKMTKTERKKRRKKETDVVEEHNGHIFKATQYSI
PTYCEFCSSLIWIMDRASVCKLCKYACHRKCCLKTTTKCSKKYDPELSSRQFGVELSRLT
SEERTVPVLFEKLTNYIEMHALYTEGIYRKSGSTNKIKELRQGLDTDIESINLDDYNIHV
IASVFKQWLRDLPNPLMTFELYDEFLRAMGLQERKEAIRGVYSVIDQLSRTHLHTLERLI
FHLVRIALQEETNRMSANALAIVFAPCILRSPDTMDPLQSAQDVSKTISCVELIVIEQMN
KYRARLKDISSLEFAENKAKSRLSLIRRSMGKGRARRGTYPSPSSPAPVRLPSVSDVPEE
ALSNEEAMEMDVTEQQQVAMQQEERVLTEQIESLQKEKEELTFEMLALEPRASDDETLES
EASIGTADSSENLNFDSEGTISDRSDRSLALGLARPGKTEPHGSTRSRRHLRKQQESVDS
VDSSVSSPAVSPSSSSSCLPHVTRKRFQIYSKSPFYRAVPSGGGATVERSPGLLIKGLDD
RPQFTTRGTFNPEKGKQKLKNVKNSPPKAKELPEGAAGTSRKRHPDAADYTSPQQLVLLG
NNEFMV
Download sequence
Identical sequences H9GI79
ENSACAP00000011640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]