SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000012547 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000012547
Domain Number 1 Region: 374-428,466-590
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000353
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 2 Region: 548-682
Classification Level Classification E-value
Superfamily EF-hand 0.0000001
Family Calmodulin-like 0.038
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000012547
Domain Number - Region: 78-88
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0167
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000012547   Gene: ENSACAG00000012695   Transcript: ENSACAT00000012803
Sequence length 873
Comment pep:known_by_projection chromosome:AnoCar2.0:5:45599248:45617326:1 gene:ENSACAG00000012695 transcript:ENSACAT00000012803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGGLEQLELGQLRESPSSPSSSPLSSCSRQAWSRDNPGFEAEAEEDGAKAAGKGPVLQM
EPSQLPQESGEAAESPLPSPPPPPSPPPRRLAWAKGWARRLRGLWGTRLMEETTTREKYL
KSVLRELITYLMFLLVLSILSYGMVSSNMYYYTKAMSQVFLDTPISKMEKINFKTLSTME
DFWKFTEGPLLDGLYWDMWYNNKTVTENRSFIYHENLLLGIPRMRQLKVRNGSCLIPEDL
QDEIKDCYSVYSVGNEDTAPFGLRNGTAWTYSSEKDLHGSSYWGLIATYSGGGYYQDLSK
SREKTSDLIAGLKNNLWLDRGTRATFIDFSVYNANINLFCIVRLLVEFPPTGGLLTSWQF
QPVKLIHYISTFDFFLAACEIIFCLFIIYYVVEEILEIHIHRLFYFRSLWNCLDVLIILL
SVAAIGINIYQTSAVDRMLKELLENQNSFPNFESLSYWQTQFNSIAAITMFFVWMKLFKF
INFNRTMSQLSSTMSRCAKDVLGFAIMFFIIFLAYAQLAYLVFGTQVDDFSTFPDSIFTQ
FRILLGDFDFTEVEETNRILGPVYFTTFVFFMFFILLNMFLAIINDTYSEVKSDMAQQKS
EMELSDLIKKEYTKAMVKLKLKKTPVDDISESLRQSGGKLNFDELRQNLKGKGHTDAEIE
AIFTKYDQDGDQELTELEHQQMRDDLEKEREDLDLDRSSLNRPLSGRSFPRSLDDSEEDD
DDDSGHSSRRRGSSSSGVSYEEFQVLVRRVDRMEHSIGSIVSKVDAVIMKLEIMEKAKLK
RKEVLGRLLDGVTEDERLGRENEMHRDQMERLVREELERWESDDAASQVSHRLGTPMGLN
GQSRARSSRPSSSQSTEGAEGGGAGNGGSNVNV
Download sequence
Identical sequences G1KMS9
ENSACAP00000012547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]