SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000015945 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000015945
Domain Number 1 Region: 631-724
Classification Level Classification E-value
Superfamily TAFH domain-like 7.46e-36
Family TAFH domain-like 0.00000285
Further Details:      
 
Domain Number 2 Region: 916-963
Classification Level Classification E-value
Superfamily Histone-fold 2.72e-16
Family TBP-associated factors, TAFs 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000015945   Gene: ENSACAG00000016214   Transcript: ENSACAT00000016263
Sequence length 1129
Comment pep:known_by_projection chromosome:AnoCar2.0:4:150442267:150548065:-1 gene:ENSACAG00000016214 transcript:ENSACAT00000016263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGSDLLDEVFLNAEVDEKVVSDLVGSLESQLAASGHHRGHHRPPEGLRAAATAAAGQL
LGNHVVSGGGGSSSPSPGGGGGGGGGGNASAQTGSPGTTTTTTTSSSSSSSSAAATTTAN
NAAAKMGLSGPETTKPGAGGVQGSVINHNARSQGSTLDGATTTSVSTTTNVQGGSEAAVT
PGTLNQGKSVVISTMATALSTRNGKIGSTTVQTLNGSNVVMNSHTSFTATPATANPAIVP
AVTPLVNNGPGNVGKVSTVNALLPSASNTVIQTSFLGTGVSSASSPSPTVISSQQPPGLG
TGGPTVALVRPPIHAAGPSVAAATQNGSNTVINSTISVGSFPAAAVAAATVGSGVSLQTS
LVNSQPGSGVPTAPTTQVIKSESPKTIVQTVTQQQTLAAGGQPSTTGGNMIIGQTMQAGL
PNVAPNPGGVPPAPGTPTGLVKGAANTVTQSLPRTPAATTSGIRATLTPTVLAPRQPPQN
PTNIQNFQLPPGMVLVRSENGQLLMIPQHALAQMQAQAHAQSQSQATMTPRPATPTSASP
VQLSTVQVSSLRNAPGTPIIARQVAPTTIIKQVSQAQTTVQPTTTLQRPPVVQPQIVLGS
PAQTTTLGTASAVQTGTPQRTVQGATATSTVATETMENVKKCKNFLSTLIKLASSGKQST
ETAANVKELVQNLLDGKIEAEDFTSRLYRELNSSPQPYLVPFLKRSLPALRQLTPDSAAF
IQQSQHQQPTTQPTTALTAVMLSGSVQRTAGKTTATVTSTLQQPVISLTQPTQVGVGKQG
QPTQVVIQQSQKPGTLIRPPQVTLTQTPMVALRPPHNRIMLTAPQQIQLNPLQTVPVVKQ
TVLPGTKALSTLSSQAAAAQKNKLKEPGGGSFRDDDDINDVASMAGVNLSEESARILATN
SELVGTLTRSCKDETFLLPAPLQRRILEIGKKHGITEIHPDVVSYVSHATQQRLQTLVEK
VSETAQQKNLSYKDDERYDQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQ
EDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKVESPGAGSGTEGSSTSI
AVPGSSGVGTTRQFTRQRITRVNLRDLIFCLENERETSHSLLLYKAFLK
Download sequence
Identical sequences G1KSB8
ENSACAP00000015945 XP_008108358.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]