SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000020560 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000020560
Domain Number 1 Region: 12-85
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.31e-28
Family UBX domain 0.0000586
Further Details:      
 
Domain Number 2 Region: 377-465
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000491
Family UBX domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000020560   Gene: ENSACAG00000010247   Transcript: ENSACAT00000024898
Sequence length 466
Comment pep:known_by_projection chromosome:AnoCar2.0:2:118261684:118357322:-1 gene:ENSACAG00000010247 transcript:ENSACAT00000024898 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAVGGGGSSGAVSVLAPNGRRVTVRVGPSTALLQILEEVCRKQNFSPNEYDLKFQRTVL
DLSLQWRFANLPNNAKLEMVPISRNRAGTETAVRIALQLDDGSRLQDTFSSTHTLWDILH
HFSQTREYVEEHCEVSPICIYMRDEVTGKTALEKTSLKSLGLTGGNAIIRLVKLLCFLIV
MLGKAPCSTGSTSSGEEQAGSPVPHSPVFSTSSVCSHDPALDKKCTDKQDLNKESQKSSE
EHQPASEPVPSSFVPFVGDGQRLGGGSPVEMISPMSDVPMSNLAQSLSSPGGPSKPKKSK
NSQGKPKEEKEREKKRNPKNKTIIEQLIDSECLEREPIVCHPDLQHPLGSASQDLPDEFF
EVTVDDVRKRLAQLQNERKRLEETPLMTQAQREAQIKEKLERYPKVVLRVYFPDRHILQG
FFHPCETVGALRAFVKSHLADPEIPFYLFITPPRSILTEDSLTLFQ
Download sequence
Identical sequences G1KY22
ENSACAP00000020560 ENSACAP00000020560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]