SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000022109 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000022109
Domain Number 1 Region: 409-571
Classification Level Classification E-value
Superfamily PUA domain-like 1.39e-61
Family SRA domain-like 0.0000000486
Further Details:      
 
Domain Number 2 Region: 1-85
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.84e-18
Family Ubiquitin-related 0.0000541
Further Details:      
 
Domain Number 3 Region: 324-379
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000642
Family PHD domain 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000022109
Domain Number - Region: 305-330
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 0.0412
Family Dual specificity phosphatase-like 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000022109   Gene: ENSACAG00000008483   Transcript: ENSACAT00000029527
Sequence length 601
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343661.1:236154:257962:-1 gene:ENSACAG00000008483 transcript:ENSACAT00000029527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWIQVRTMDGKETHRVDSLSKLTKVEDLRQKIFETFNVAPDRQRLFYRGKQMEDGHSLFD
YSVGLNDIVQLLVRQSPALQPAAGKEKDSELSDTDSGCGPSESDKSSNNGEGSVEMEGHP
GVAAPLDLVDPGFGFYKINELVDARDTSMGAWFEAIVVNVTQKGEAASKVTESDEETDMP
EVIPDEDIVYHVKYEDYPENGVIQLSSKNVRARARSTLQWEELSPGDVVMLNYNPDDPKE
RGFWYDAEILQKRESRTYKELYAKIVLGDGGDVLNDCRITLVDEIYKIEEPGNAVPLTIA
SPMKRQSGPVCKHCKDNPSKTCRMCACYICGGKQDPEKQLMCDECDMAFHIYCLNPPLSR
IPDDEDWYCPECRNDASEVVLAGEKLKESKKKAKMASANSSSQRDWGKGMACVGRTRECT
IVPSNHYGPIPGVPVGTMWKFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVD
HGNSFTYTGSGGRDLSGNKRTAEQSCDQKLTNMNRALALNCSAPINDKEGSEAKDWRAGK
PVRVVRNAKGGRHSKYAPKEGNRYDGIYKVCIRTGMRRKLIQRGFCLLFRCARLCCCVPL
S
Download sequence
Identical sequences R4GA29
ENSACAP00000022109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]